Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP1R15B AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit PPP1R15B Polyclonal Antibody | anti-PPP1R15B antibody

PPP1R15B antibody - C-terminal region

Gene Names
PPP1R15B; CREP; MSSGM2
Reactivity
Cow, Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP1R15B; Polyclonal Antibody; PPP1R15B antibody - C-terminal region; anti-PPP1R15B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL
Sequence Length
713
Applicable Applications for anti-PPP1R15B antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 91%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PPP1R15B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP1R15B AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-PPP1R15B AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-PPP1R15B antibody
This is a rabbit polyclonal antibody against PPP1R15B. It was validated on Western Blot

Target Description: PPP1R15B promotes dephosphorylation of the transcription initiation factor EIF2-alpha through recruitment of protein phosphatase-1 (PP1) catalytic subunits.
Product Categories/Family for anti-PPP1R15B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 15B
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 15B
NCBI Official Symbol
PPP1R15B
NCBI Official Synonym Symbols
CREP; MSSGM2
NCBI Protein Information
protein phosphatase 1 regulatory subunit 15B
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 15B
UniProt Gene Name
PPP1R15B
UniProt Entry Name
PR15B_HUMAN

NCBI Description

This gene encodes a protein phosphatase I-interacting protein that promotes the dephosphorylation of eukaryotic translation initiation factor 2A to regulate translation under conditions of cellular stress. The transcribed messenger RNA contains two upstream open reading frames (ORFs) that repress translation of the main protein coding ORF under normal conditions, while the protein coding ORF is expressed at high levels in response to stress. Continual translation of the mRNA under conditions of eukaryotic translation initiation factor 2A inactivation is thought to create a feedback loop for reactivation of the gene during recovery from stress. In addition, it has been shown that this protein plays a role in membrane traffic that is independent of translation and that it is required for exocytosis from erythroleukemia cells. Allelic variants of this gene are associated with microcephaly, short stature, and impaired glucose metabolism. [provided by RefSeq, Feb 2016]

Uniprot Description

PPP1R15B: Maintains low levels of EIF2S1 phosphorylation in unstressed cells by promoting its dephosphorylation by PP1. Belongs to the PPP1R15 family.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: protein phosphatase type 1 complex

Molecular Function: protein binding; protein serine/threonine phosphatase activity

Biological Process: regulation of translation; response to hydrogen peroxide; ER overload response

Research Articles on PPP1R15B

Similar Products

Product Notes

The PPP1R15B ppp1r15b (Catalog #AAA3214902) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R15B antibody - C-terminal region reacts with Cow, Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R15B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R15B ppp1r15b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFCSVDPYNP QNFTATIQTA ARIVPEEPSD SEKDLSGKSD LENSSQSGSL. It is sometimes possible for the material contained within the vial of "PPP1R15B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.