Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPHLN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit PPHLN1 Polyclonal Antibody | anti-PPHLN1 antibody

PPHLN1 antibody - N-terminal region

Gene Names
PPHLN1; CR; HSPC206; HSPC232
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPHLN1; Polyclonal Antibody; PPHLN1 antibody - N-terminal region; anti-PPHLN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDR
Sequence Length
374
Applicable Applications for anti-PPHLN1 antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 80%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPHLN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPHLN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-PPHLN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-PPHLN1 antibody
This is a rabbit polyclonal antibody against PPHLN1. It was validated on Western Blot

Target Description: The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Product Categories/Family for anti-PPHLN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
periphilin-1 isoform 2
NCBI Official Synonym Full Names
periphilin 1
NCBI Official Symbol
PPHLN1
NCBI Official Synonym Symbols
CR; HSPC206; HSPC232
NCBI Protein Information
periphilin-1
UniProt Protein Name
Periphilin-1
Protein Family
UniProt Gene Name
PPHLN1
UniProt Entry Name
PPHLN_HUMAN

NCBI Description

The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

PPHLN1: Involved in epithelial differentiation and contributes to epidermal integrity and barrier formation. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; cytoplasm

Biological Process: keratinization

Research Articles on PPHLN1

Similar Products

Product Notes

The PPHLN1 pphln1 (Catalog #AAA3213579) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPHLN1 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPHLN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPHLN1 pphln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAYRRDEMWS EGRYEYERIP RERAPPRSHP SDGYNRLVNI VPKKPPLLDR. It is sometimes possible for the material contained within the vial of "PPHLN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.