Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Mouse anti-Human PPHLN1 Monoclonal Antibody | anti-PPHLN1 antibody

PPHLN1 (Periphilin-1, Gastric Cancer Antigen Ga50, HSPC206, HSPC232, MGC48786) (HRP)

Gene Names
PPHLN1; CR; HSPC206; HSPC232
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPHLN1; Monoclonal Antibody; PPHLN1 (Periphilin-1; Gastric Cancer Antigen Ga50; HSPC206; HSPC232; MGC48786) (HRP); anti-PPHLN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B6
Specificity
Recognizes human PPHLN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PPHLN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa168-259 from human PPHLN1 (NP_958846) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Testing Data

(Detection limit for recombinant GST tagged PPHLN1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPHLN1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PPHLN1 antibody
Involved in epithelial differentiation and contributes to epidermal integrity and barrier formation.
Product Categories/Family for anti-PPHLN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37
NCBI Official Full Name
periphilin-1 isoform 5
NCBI Official Synonym Full Names
periphilin 1
NCBI Official Symbol
PPHLN1
NCBI Official Synonym Symbols
CR; HSPC206; HSPC232
NCBI Protein Information
periphilin-1
UniProt Protein Name
Periphilin-1
Protein Family
UniProt Gene Name
PPHLN1
UniProt Entry Name
PPHLN_HUMAN

NCBI Description

The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

PPHLN1: Involved in epithelial differentiation and contributes to epidermal integrity and barrier formation. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; cytoplasm

Biological Process: keratinization

Research Articles on PPHLN1

Similar Products

Product Notes

The PPHLN1 pphln1 (Catalog #AAA6154295) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPHLN1 (Periphilin-1, Gastric Cancer Antigen Ga50, HSPC206, HSPC232, MGC48786) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPHLN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPHLN1 pphln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPHLN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.