Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (POLR3H antibody (MBS839730) used at 1 ug/ml to detect target protein.)

Rabbit POLR3H Polyclonal Antibody | anti-POLR3H antibody

POLR3H antibody

Gene Names
POLR3H; RPC8; RPC22.9
Applications
Western Blot
Purity
Affinity purified
Synonyms
POLR3H; Polyclonal Antibody; POLR3H antibody; Polyclonal POLR3H; Anti-POLR3H; POLRH-3; RPC8; MGC111097; POLRH 3; KIAA1665; MGC29654; RNA Polymerase III; anti-POLR3H antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
POLR3H antibody was raised against the middle region of POLR3H
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3H antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
204
Applicable Applications for anti-POLR3H antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.
Cross-Reactivity
Human
Immunogen
POLR3H antibody was raised using the middle region of POLR3H corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(POLR3H antibody (MBS839730) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (POLR3H antibody (MBS839730) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-POLR3H antibody
Rabbit polyclonal POLR3H antibody raised against the middle region of POLR3H
Product Categories/Family for anti-POLR3H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
20 kDa (MW of target protein)
NCBI Official Full Name
POLR3H, partial
NCBI Official Synonym Full Names
polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
NCBI Official Symbol
POLR3H
NCBI Official Synonym Symbols
RPC8; RPC22.9
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC8
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC8
UniProt Gene Name
POLR3H
UniProt Synonym Gene Names
KIAA1665; RPC8; RNA polymerase III subunit C8; RPC22.9
UniProt Entry Name
RPC8_HUMAN

Uniprot Description

POLR3H: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; centrosome; DNA-directed RNA polymerase III complex; intracellular membrane-bound organelle; cytosol

Molecular Function: DNA binding; DNA-directed RNA polymerase activity

Biological Process: transcription from RNA polymerase III promoter; transcription initiation from RNA polymerase III promoter; termination of RNA polymerase III transcription; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; positive regulation of interferon type I production; innate immune response; gene expression; defense response to virus; RNA elongation from RNA polymerase III promoter

Research Articles on POLR3H

Similar Products

Product Notes

The POLR3H polr3h (Catalog #AAA839730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's POLR3H can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the POLR3H polr3h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR3H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.