Mouse anti-Human WTAP Monoclonal Antibody | anti-WTAP antibody

WTAP (Wilms Tumor 1-associating Protein, WT1-associated Protein, Pre-mRNA-splicing Regulator WTAP, Female-lethal(2)D Homolog, hFL(2)D, KIAA0105) (FITC)

Cat. Num. AAA6150486

• Gene Names: WTAP; Mum2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WTAP; Monoclonal Antibody; WTAP (Wilms Tumor 1-associating Protein; WT1-associated Protein; Pre-mRNA-splicing Regulator WTAP; Female-lethal(2)D Homolog; hFL(2)D; KIAA0105) (FITC); anti-WTAP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B11
• Specificity: Recognizes human WTAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1724

• Applicable Applications for anti-WTAP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa70-151 from WTAP (NP_690596) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.76kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged WTAP is 0.1ng/ml as a capture antibo)

Product Categories/Family for anti-WTAP antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 395455087
• NCBI GeneID: 9589
• NCBI Accession #: NM_152857.2
• NCBI GenBank Nucleotide #: NM_152857
• UniProt Accession #: Q15007
• NCBI Official Full Name: Homo sapiens WT1 associated protein (WTAP), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: WT1 associated protein
• NCBI Official Symbol: WTAP
• NCBI Official Synonym Symbols: Mum2
• NCBI Protein Information: pre-mRNA-splicing regulator WTAP
• UniProt Protein Name: Pre-mRNA-splicing regulator WTAP
• Protein Family: Pre-mRNA-splicing regulator
• UniProt Gene Name: WTAP
• UniProt Synonym Gene Names: KIAA0105; hFL(2)D
• UniProt Entry Name: FL2D_HUMAN

NCBI Description

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

WTAP: Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability. Impairs WT1 DNA- binding ability and inhibits expression of WT1 target genes. May be involved in mRNA splicing regulation. Belongs to the fl(2)d family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Spliceosome

Chromosomal Location of Human Ortholog: 6q25-q27

Cellular Component: nucleoplasm; nuclear membrane; nucleolus; nuclear speck; nucleus

Biological Process: RNA splicing; cell cycle; mRNA processing; regulation of alternative nuclear mRNA splicing, via spliceosome