Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of POLR1D expression in transfected 293T cell line by POLR1D polyclonal antibody. Lane 1: POLR1D transfected lysate (15.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human POLR1D Polyclonal Antibody | anti-POLR1D antibody

POLR1D (DNA-directed RNA Polymerases I and III Subunit RPAC2, AC19, DNA-directed RNA Polymerase I Subunit D, RNA Polymerase I 16kD Subunit, RPC16, hRPA19, FLJ20616, MGC9850)

Gene Names
POLR1D; AC19; RPA9; TCS2; RPA16; RPAC2; RPC16; POLR1C; RPO1-3
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
POLR1D; Polyclonal Antibody; POLR1D (DNA-directed RNA Polymerases I and III Subunit RPAC2; AC19; DNA-directed RNA Polymerase I Subunit D; RNA Polymerase I 16kD Subunit; RPC16; hRPA19; FLJ20616; MGC9850); Anti -POLR1D (DNA-directed RNA Polymerases I and III Subunit RPAC2; anti-POLR1D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human POLR1D.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Applicable Applications for anti-POLR1D antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human POLR1D, aa1-133 (NP_057056.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of POLR1D expression in transfected 293T cell line by POLR1D polyclonal antibody. Lane 1: POLR1D transfected lysate (15.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POLR1D expression in transfected 293T cell line by POLR1D polyclonal antibody. Lane 1: POLR1D transfected lysate (15.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of POLR1D transfected lysate using POLR1D rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with POLR1D rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of POLR1D transfected lysate using POLR1D rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with POLR1D rabbit polyclonal antibody.)
Related Product Information for anti-POLR1D antibody
DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity.
Product Categories/Family for anti-POLR1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
15,237 Da
NCBI Official Full Name
POLR1D protein
NCBI Official Synonym Full Names
polymerase (RNA) I polypeptide D, 16kDa
NCBI Official Symbol
POLR1D
NCBI Official Synonym Symbols
AC19; RPA9; TCS2; RPA16; RPAC2; RPC16; POLR1C; RPO1-3
NCBI Protein Information
DNA-directed RNA polymerases I and III subunit RPAC2; RNA polymerases I and III subunit AC2; DNA-directed RNA polymerase I subunit D
UniProt Protein Name
DNA-directed RNA polymerases I and III subunit RPAC2
UniProt Gene Name
POLR1D
UniProt Synonym Gene Names
RNA polymerases I and III subunit AC2; RPA16
UniProt Entry Name
RPAC2_HUMAN

NCBI Description

The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011]

Uniprot Description

POLR1D: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. Defects in POLR1D are the cause of Treacher Collins syndrome type 2 (TCS2). A form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss. Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 13q12.2

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; cytosol; DNA-directed RNA polymerase I complex

Molecular Function: protein dimerization activity; DNA binding

Biological Process: transcription from RNA polymerase III promoter; termination of RNA polymerase III transcription; negative regulation of gene expression, epigenetic; positive regulation of interferon type I production; innate immune response; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter; regulation of gene expression, epigenetic; RNA elongation from RNA polymerase III promoter

Research Articles on POLR1D

Similar Products

Product Notes

The POLR1D polr1d (Catalog #AAA6013280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR1D (DNA-directed RNA Polymerases I and III Subunit RPAC2, AC19, DNA-directed RNA Polymerase I Subunit D, RNA Polymerase I 16kD Subunit, RPC16, hRPA19, FLJ20616, MGC9850) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the POLR1D polr1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEEDQELERK ISGLKTSMAE GERKTALEMV QAAGTDRHCV TFVLHEEDHT LGNSLRYMIM KNPEVEFCGY TTTHPSESKI NLRIQTRGTL PAVEPFQRGL NELMNVCQHV LDKFEASIKD YKDQKASRNE STF. It is sometimes possible for the material contained within the vial of "POLR1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.