Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POLDIP3 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellPOLDIP3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit POLDIP3 Polyclonal Antibody | anti-POLDIP3 antibody

POLDIP3 antibody - C-terminal region

Gene Names
POLDIP3; SKAR; PDIP3; PDIP46
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLDIP3; Polyclonal Antibody; POLDIP3 antibody - C-terminal region; anti-POLDIP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVT
Sequence Length
392
Applicable Applications for anti-POLDIP3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POLDIP3 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellPOLDIP3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-POLDIP3 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellPOLDIP3 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-POLDIP3 antibody
This is a rabbit polyclonal antibody against POLDIP3. It was validated on Western Blot

Target Description: POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
polymerase delta-interacting protein 3 isoform 2
NCBI Official Synonym Full Names
DNA polymerase delta interacting protein 3
NCBI Official Symbol
POLDIP3
NCBI Official Synonym Symbols
SKAR; PDIP3; PDIP46
NCBI Protein Information
polymerase delta-interacting protein 3
UniProt Protein Name
Polymerase delta-interacting protein 3
UniProt Gene Name
POLDIP3
UniProt Synonym Gene Names
KIAA1649; PDIP46; p46; SKAR
UniProt Entry Name
PDIP3_HUMAN

NCBI Description

This gene encodes an RRM (RNA recognition motif)-containing protein that participates in the regulation of translation by recruiting ribosomal protein S6 kinase beta-1 to mRNAs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

SKAR: Is involved in regulation of translation. Is preferentially associated with CBC-bound spliced mRNA-protein complexes during the pioneer round of mRNA translation. Contributes to enhanced translational efficiency of spliced over nonspliced mRNAs. Recruits activated ribosomal protein S6 kinase beta-1 I/RPS6KB1 to newly synthesized mRNA. Interacts with POLD2. Interacts with NCBP1 and EIF4A3. Associates with the multiprotein exon junction complex (EJC). Interacts with RPS6KB1 (activated). Interacts with ERH. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nuclear speck

Molecular Function: protein binding; nucleotide binding

Biological Process: poly(A)+ mRNA export from nucleus; positive regulation of translation

Research Articles on POLDIP3

Similar Products

Product Notes

The POLDIP3 poldip3 (Catalog #AAA3205617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLDIP3 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POLDIP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLDIP3 poldip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLRLSDSPSM KKESELPRRV NSASSSNPPA EVDPDTILKA LFKSSGASVT. It is sometimes possible for the material contained within the vial of "POLDIP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.