Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DPOD1 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)

Rabbit anti-Human POLD1 Polyclonal Antibody | anti-POLD1 antibody

POLD1 Antibody - N-terminal region

Gene Names
POLD1; CDC2; MDPL; POLD; CRCS10
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
POLD1; Polyclonal Antibody; POLD1 Antibody - N-terminal region; anti-POLD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEEL
Sequence Length
1107
Applicable Applications for anti-POLD1 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-POLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human DPOD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DPOD1 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-DPOD1 antibody Titration: 1 ug/mLSample Type: Human 293T Whole Cell)
Related Product Information for anti-POLD1 antibody
This is a rabbit polyclonal antibody against DPOD1. It was validated on Western Blot

Target Description: This gene encodes the 125-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6.
Product Categories/Family for anti-POLD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121 kDa
NCBI Official Full Name
DNA polymerase delta catalytic subunit isoform 1
NCBI Official Synonym Full Names
DNA polymerase delta 1, catalytic subunit
NCBI Official Symbol
POLD1
NCBI Official Synonym Symbols
CDC2; MDPL; POLD; CRCS10
NCBI Protein Information
DNA polymerase delta catalytic subunit
UniProt Protein Name
DNA polymerase delta catalytic subunit
Protein Family
UniProt Gene Name
POLD1
UniProt Synonym Gene Names
POLD
UniProt Entry Name
DPOD1_HUMAN

NCBI Description

This gene encodes the 125-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Mar 2012]

Uniprot Description

POLD1: Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex. Belongs to the DNA polymerase type-B family.

Protein type: EC 2.7.7.7; Transferase; DNA repair, damage; Nucleotide Metabolism - pyrimidine; Hydrolase; Nucleotide Metabolism - purine; DNA replication

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; delta DNA polymerase complex; nucleotide-excision repair complex; membrane; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; metal ion binding; 4 iron, 4 sulfur cluster binding; nucleotide binding; DNA-directed DNA polymerase activity; 3'-5'-exodeoxyribonuclease activity; chromatin binding

Biological Process: mismatch repair; DNA strand elongation during DNA replication; DNA repair; base-excision repair, gap-filling; telomere maintenance via semi-conservative replication; DNA synthesis during DNA repair; DNA replication proofreading; nucleotide-excision repair; base-excision repair; fatty acid homeostasis; transcription-coupled nucleotide-excision repair; telomere maintenance via recombination; mitotic cell cycle; nucleotide-excision repair, DNA gap filling; DNA replication; DNA catabolic process, exonucleolytic; telomere maintenance; response to UV

Disease: Colorectal Cancer, Susceptibility To, 10; Mandibular Hypoplasia, Deafness, Progeroid Features, And Lipodystrophy Syndrome

Research Articles on POLD1

Similar Products

Product Notes

The POLD1 pold1 (Catalog #AAA3219908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLD1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLD1 pold1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGPGVPPKRA RGGLWDDDDA PRPSQFEEDL ALMEEMEAEH RLQEQEEEEL. It is sometimes possible for the material contained within the vial of "POLD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.