Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Stomach)

Rabbit anti-Human POFUT2 Polyclonal Antibody | anti-POFUT2 antibody

POFUT2 antibody - C-terminal region

Gene Names
POFUT2; FUT13; C21orf80
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
POFUT2; Polyclonal Antibody; POFUT2 antibody - C-terminal region; anti-POFUT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP
Sequence Length
424
Applicable Applications for anti-POFUT2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human POFUT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Stomach)

Immunohistochemistry (IHC) (Human Stomach)

Western Blot (WB)

(WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: HepG2There is BioGPS gene expression data showing that POFUT2 is expressed in HepG2)

Western Blot (WB) (WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: HepG2There is BioGPS gene expression data showing that POFUT2 is expressed in HepG2)
Related Product Information for anti-POFUT2 antibody
This is a rabbit polyclonal antibody against POFUT2. It was validated on Western Blot and immunohistochemistry

Target Description: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
GDP-fucose protein O-fucosyltransferase 2 isoform A
NCBI Official Synonym Full Names
protein O-fucosyltransferase 2
NCBI Official Symbol
POFUT2
NCBI Official Synonym Symbols
FUT13; C21orf80
NCBI Protein Information
GDP-fucose protein O-fucosyltransferase 2
UniProt Protein Name
GDP-fucose protein O-fucosyltransferase 2
UniProt Gene Name
POFUT2
UniProt Synonym Gene Names
C21orf80; FUT13; KIAA0958; O-FucT-2
UniProt Entry Name
OFUT2_HUMAN

NCBI Description

Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).[supplied by OMIM, Mar 2008]

Uniprot Description

POFUT2: Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Belongs to the glycosyltransferase 68 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.4.1.221

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane

Molecular Function: peptide-O-fucosyltransferase activity

Biological Process: fucose metabolic process; protein amino acid O-linked glycosylation; cellular protein metabolic process; mesoderm formation; regulation of gene expression; regulation of secretion; post-translational protein modification

Research Articles on POFUT2

Similar Products

Product Notes

The POFUT2 pofut2 (Catalog #AAA3207941) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POFUT2 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POFUT2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the POFUT2 pofut2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFEPTWEELE LYKDGGVAII DQWICAHARC LPTSLSAESG SGGFQRFFCP. It is sometimes possible for the material contained within the vial of "POFUT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.