Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PNRC2 Polyclonal Antibody)

Rabbit anti-Mouse PNRC2 Polyclonal Antibody | anti-PNRC2 antibody

PNRC2 Polyclonal Antibody

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PNRC2; Polyclonal Antibody; PNRC2 Polyclonal Antibody; proline-rich nuclear receptor coactivator 2; anti-PNRC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.68 mg/ml (varies by lot)
Sequence Length
139
Applicable Applications for anti-PNRC2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNRC2 (NP_060231.1).
Immunogen Sequence
MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSE
Positive Samples
Mouse Lung
Cellular Location
Cytoplasm, Nucleus, P-body
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PNRC2 Polyclonal Antibody)

Western Blot (WB) (Western blot-PNRC2 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 13kDa; 15kDa
Observed: 16kDa
NCBI Official Full Name
proline-rich nuclear receptor coactivator 2
NCBI Official Synonym Full Names
proline rich nuclear receptor coactivator 2
NCBI Official Symbol
PNRC2
NCBI Protein Information
proline-rich nuclear receptor coactivator 2
UniProt Protein Name
Proline-rich nuclear receptor coactivator 2
UniProt Gene Name
PNRC2
UniProt Entry Name
PNRC2_HUMAN

Uniprot Description

PNRC2: Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. Required for UPF1/RENT1 localization to the P-body. Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure. Belongs to the PNRC family. PNRC2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; deadenylation-independent decapping; mRNA catabolic process, nonsense-mediated decay

Research Articles on PNRC2

Similar Products

Product Notes

The PNRC2 pnrc2 (Catalog #AAA9140907) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNRC2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PNRC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PNRC2 pnrc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PNRC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.