Western Blot (WB)
(WB Suggested Anti-ZFP106 Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: Human muscle)
Rabbit ZFP106 Polyclonal Antibody | anti-ZNF106 antibody
ZFP106 antibody - N-terminal region
Gene Names
ZNF106; SH3BP3; ZFP106; ZNF474
Reactivity
Cow, Dog, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZFP106; Polyclonal Antibody; ZFP106 antibody - N-terminal region; anti-ZNF106 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESAS
Sequence Length
1883
Applicable Applications for anti-ZNF106 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP106
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZFP106 Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: Human muscle)
Western Blot (WB)
(WB Suggested Anti-ZFP106 Antibody Titration: 0.125ug/mlELISA Titer: 1:62500Positive Control: Human muscle)
Related Product Information for anti-ZNF106 antibody
This is a rabbit polyclonal antibody against ZFP106. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZFP106 is a new candidate transcription factor
Target Description: ZFP106 is a new candidate transcription factor
Product Categories/Family for anti-ZNF106 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
209kDa
NCBI Official Full Name
zinc finger protein 106 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 106
NCBI Official Symbol
ZNF106
NCBI Official Synonym Symbols
SH3BP3; ZFP106; ZNF474
NCBI Protein Information
zinc finger protein 106
UniProt Protein Name
Zinc finger protein 106
Protein Family
UniProt Gene Name
ZNF106
UniProt Synonym Gene Names
SH3BP3; ZFP106; ZNF474; Zfp-106
UniProt Entry Name
ZN106_HUMAN
Uniprot Description
ZFP106: a protein with six WD40 domains and a zinc-finger domain. May be involved in growth related metabolism. A region of ZFP106 is identical to a 600-amino acid sequence implicated in the insulin receptor signaling pathway. Regulated by NRF-1 and myogenin, and expressed in brown fat, developing brain, and striated muscle.
Protein type: C2H2-type zinc finger protein; Nucleolus; Adaptor/scaffold
Chromosomal Location of Human Ortholog: 15q15.1
Cellular Component: membrane; nucleolus; cytosol
Molecular Function: opioid peptide activity; metal ion binding; SH3 domain binding
Biological Process: insulin receptor signaling pathway
Research Articles on ZNF106
Similar Products
Product Notes
The ZNF106 znf106 (Catalog #AAA3201419) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP106 antibody - N-terminal region reacts with Cow, Dog, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP106 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF106 znf106 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKESELQMTS AASPHPGLLL DLKTSLEDAQ VDDSIKSHVS YETEGFESAS. It is sometimes possible for the material contained within the vial of "ZFP106, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
