Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PNPLA8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit PNPLA8 Polyclonal Antibody | anti-PNPLA8 antibody

PNPLA8 antibody - middle region

Gene Names
PNPLA8; MMLA; IPLA2G; IPLA2-2; iPLA2gamma; PNPLA-gamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PNPLA8; Polyclonal Antibody; PNPLA8 antibody - middle region; anti-PNPLA8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY
Sequence Length
782
Applicable Applications for anti-PNPLA8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PNPLA8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PNPLA8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-PNPLA8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-PNPLA8 antibody
This is a rabbit polyclonal antibody against PNPLA8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam
Product Categories/Family for anti-PNPLA8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
calcium-independent phospholipase A2-gamma isoform 1
NCBI Official Synonym Full Names
patatin like phospholipase domain containing 8
NCBI Official Symbol
PNPLA8
NCBI Official Synonym Symbols
MMLA; IPLA2G; IPLA2-2; iPLA2gamma; PNPLA-gamma
NCBI Protein Information
calcium-independent phospholipase A2-gamma
UniProt Protein Name
Calcium-independent phospholipase A2-gamma
UniProt Gene Name
PNPLA8
UniProt Synonym Gene Names
IPLA22; IPLA2G; iPLA2-gamma
UniProt Entry Name
PLPL8_HUMAN

NCBI Description

This gene encodes a member of the patatin-like phospholipase domain containing protein family. Members of this family are phospholipases which catalyze the cleavage of fatty acids from membrane phospholipids. The product of this gene is a calcium-independent phospholipase. Mutations in this gene have been associated with mitochondrial myopathy with lactic acidosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2015]

Uniprot Description

PNPLA8: Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Phospholipase; Membrane protein, integral; EC 3.1.1.5

Chromosomal Location of Human Ortholog: 7q31

Cellular Component: Golgi membrane; peroxisomal membrane; endoplasmic reticulum membrane; membrane; perinuclear region of cytoplasm; integral to membrane; peroxisome; intracellular

Molecular Function: calcium-independent phospholipase A2 activity; ATP binding; lysophospholipase activity

Biological Process: cell death; phosphatidylethanolamine catabolic process; phospholipid metabolic process; glycerophospholipid biosynthetic process; arachidonic acid metabolic process; linoleic acid metabolic process; fatty acid metabolic process; prostaglandin biosynthetic process; arachidonic acid secretion

Disease: Mitochondrial Myopathy With Lactic Acidosis

Research Articles on PNPLA8

Similar Products

Product Notes

The PNPLA8 pnpla8 (Catalog #AAA3212980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNPLA8 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PNPLA8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PNPLA8 pnpla8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDNRTRALVQ ALRRTTDPKL CITRVEELTF HLLEFPEGKG VAVKERIIPY. It is sometimes possible for the material contained within the vial of "PNPLA8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.