Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUDT2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Rabbit NUDT2 Polyclonal Antibody | anti-NUDT2 antibody

NUDT2 antibody - middle region

Gene Names
NUDT2; APAH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUDT2; Polyclonal Antibody; NUDT2 antibody - middle region; anti-NUDT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD
Sequence Length
147
Applicable Applications for anti-NUDT2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUDT2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-NUDT2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-NUDT2 antibody
This is a rabbit polyclonal antibody against NUDT2. It was validated on Western Blot

Target Description: This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene.
Product Categories/Family for anti-NUDT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
318
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
bis(5'-nucleosyl)-tetraphosphatase
NCBI Official Synonym Full Names
nudix hydrolase 2
NCBI Official Symbol
NUDT2
NCBI Official Synonym Symbols
APAH1
NCBI Protein Information
bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
UniProt Protein Name
Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
Protein Family
UniProt Gene Name
NUDT2
UniProt Synonym Gene Names
APAH1; Ap4A hydrolase; Ap4Aase; Diadenosine tetraphosphatase; Nudix motif 2
UniProt Entry Name
AP4A_HUMAN

NCBI Description

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]

Uniprot Description

NUDT2: Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis. Belongs to the Nudix hydrolase family.

Protein type: Hydrolase; Nucleotide Metabolism - pyrimidine; Apoptosis; Nucleotide Metabolism - purine; EC 3.6.1.17

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: mitochondrion

Molecular Function: GTP binding; bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity; bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity

Biological Process: apoptosis; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process

Research Articles on NUDT2

Similar Products

Product Notes

The NUDT2 nudt2 (Catalog #AAA3215708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUDT2 nudt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETALRETQEE AGIEAGQLTI IEGFKRELNY VARNKPKTVI YWLAEVKDYD. It is sometimes possible for the material contained within the vial of "NUDT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.