Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PNPHSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PNP Polyclonal Antibody | anti-PNP antibody

PNP Antibody - middle region

Gene Names
PNP; NP; PUNP; PRO1837
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PNP; Polyclonal Antibody; PNP Antibody - middle region; anti-PNP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTW
Sequence Length
289
Applicable Applications for anti-PNP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PNPH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PNPHSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PNPHSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PNP antibody
This is a rabbit polyclonal antibody against PNPH. It was validated on Western Blot

Target Description: This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
purine nucleoside phosphorylase
NCBI Official Synonym Full Names
purine nucleoside phosphorylase
NCBI Official Symbol
PNP
NCBI Official Synonym Symbols
NP; PUNP; PRO1837
NCBI Protein Information
purine nucleoside phosphorylase
UniProt Protein Name
Purine nucleoside phosphorylase
UniProt Gene Name
PNP
UniProt Synonym Gene Names
NP; PNP
UniProt Entry Name
PNPH_HUMAN

NCBI Description

This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

NP: a metabolic enzyme with purine-nucleoside phosphorylase activity. Defects are the cause of nucleoside phosphorylase deficiency (NP deficiency), with severe T-cell immunodeficiency with neurologic disorder in children.

Protein type: Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 2.4.2.1; Transferase

Chromosomal Location of Human Ortholog: 14q13.1

Cellular Component: cytoskeleton; cytoplasm; intracellular; cytosol

Molecular Function: purine binding; nucleoside binding; drug binding; phosphate binding; purine-nucleoside phosphorylase activity

Biological Process: response to drug; nicotinamide riboside catabolic process; inosine catabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; purine nucleotide catabolic process; immune response; positive regulation of T cell proliferation; positive regulation of alpha-beta T cell differentiation; purine base metabolic process; purine salvage

Disease: Purine Nucleoside Phosphorylase Deficiency

Research Articles on PNP

Similar Products

Product Notes

The PNP pnp (Catalog #AAA3219903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNP Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PNP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PNP pnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IMLIRDHINL PGFSGQNPLR GPNDERFGDR FPAMSDAYDR TMRQRALSTW. It is sometimes possible for the material contained within the vial of "PNP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.