Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PMAIP1Sample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse PMAIP1 Polyclonal Antibody | anti-PMAIP1 antibody

PMAIP1 Antibody - middle region

Gene Names
Pmaip1; Noxa
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
PMAIP1; Polyclonal Antibody; PMAIP1 Antibody - middle region; anti-PMAIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVN
Sequence Length
103
Applicable Applications for anti-PMAIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse PMAIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PMAIP1Sample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PMAIP1Sample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PMAIP1 antibody
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1 (By similarity). Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1.
Product Categories/Family for anti-PMAIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11 kDa
NCBI Official Full Name
phorbol-12-myristate-13-acetate-induced protein 1
NCBI Official Synonym Full Names
phorbol-12-myristate-13-acetate-induced protein 1
NCBI Official Symbol
Pmaip1
NCBI Official Synonym Symbols
Noxa
NCBI Protein Information
phorbol-12-myristate-13-acetate-induced protein 1
UniProt Protein Name
Phorbol-12-myristate-13-acetate-induced protein 1
UniProt Gene Name
Pmaip1
UniProt Synonym Gene Names
Noxa
UniProt Entry Name
APR_MOUSE

Uniprot Description

NOXA: Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1. Interacts with MCL1, BCL2A1 and BAX. Up-regulated by p53/TP53, phorbol esters, double- stranded RNA, IFNB1/IFN-beta and viruses. Highly expressed in adult T-cell leukemia cell line. Belongs to the PMAIP1 family.

Protein type: Apoptosis; Mitochondrial

Cellular Component: mitochondrion; intracellular

Molecular Function: protein binding

Biological Process: caspase activation; release of cytochrome c from mitochondria; apoptosis; positive regulation of apoptosis; regulation of apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; negative regulation of fibroblast proliferation; positive regulation of neuron apoptosis; T cell homeostasis; positive regulation of DNA damage response, signal transduction by p53 class mediator; response to DNA damage stimulus; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; response to UV; response to X-ray

Research Articles on PMAIP1

Similar Products

Product Notes

The PMAIP1 pmaip1 (Catalog #AAA3223682) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PMAIP1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PMAIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PMAIP1 pmaip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TWSAPDITVV LAQMPGKSQK SRMRSPSPTR VPADLKDECA QLRRIGDKVN. It is sometimes possible for the material contained within the vial of "PMAIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.