Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLEKHA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit PLEKHA1 Polyclonal Antibody | anti-PLEKHA1 antibody

PLEKHA1 antibody - N-terminal region

Gene Names
PLEKHA1; TAPP1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLEKHA1; Polyclonal Antibody; PLEKHA1 antibody - N-terminal region; anti-PLEKHA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ
Sequence Length
404
Applicable Applications for anti-PLEKHA1 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLEKHA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-PLEKHA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-PLEKHA1 antibody
This is a rabbit polyclonal antibody against PLEKHA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
pleckstrin homology domain-containing family A member 1 isoform 1
NCBI Official Synonym Full Names
pleckstrin homology domain containing A1
NCBI Official Symbol
PLEKHA1
NCBI Official Synonym Symbols
TAPP1
NCBI Protein Information
pleckstrin homology domain-containing family A member 1
UniProt Protein Name
Pleckstrin homology domain-containing family A member 1
UniProt Gene Name
PLEKHA1
UniProt Synonym Gene Names
TAPP1; PH domain-containing family A member 1; TAPP-1

NCBI Description

This gene encodes a pleckstrin homology domain-containing adapter protein. The encoded protein is localized to the plasma membrane where it specifically binds phosphatidylinositol 3,4-bisphosphate. This protein may be involved in the formation of signaling complexes in the plasma membrane. Polymorphisms in this gene are associated with age-related macular degeneration. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5.[provided by RefSeq, Sep 2010]

Uniprot Description

PLEKHA1: Binds specifically to phosphatidylinositol 3,4- diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 10q26.13

Cellular Component: cytoplasm; cytosol; nucleoplasm; nucleus; plasma membrane

Molecular Function: PDZ domain binding; phosphatidylinositol-3,4-bisphosphate binding; protein binding

Biological Process: androgen metabolic process; B cell receptor signaling pathway; establishment of protein localization; estrogen metabolic process; Leydig cell differentiation; luteinization; multicellular organism growth; negative regulation of protein kinase B signaling cascade; palate development; phosphatidylinositol biosynthetic process; phosphoinositide 3-kinase cascade; platelet-derived growth factor receptor signaling pathway; post-embryonic development; ruffle organization; skeletal morphogenesis; spermatogenesis

Disease: Macular Degeneration, Age-related, 1

Research Articles on PLEKHA1

Similar Products

Product Notes

The PLEKHA1 plekha1 (Catalog #AAA3213417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLEKHA1 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLEKHA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLEKHA1 plekha1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNKAIKITVP KQSDSQPNSD NLSRHGECGK KQVSYRTDIV GGVPIITPTQ. It is sometimes possible for the material contained within the vial of "PLEKHA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.