Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 22ug mouse liver cell lysateLane 2: 22ug mouse liver cell lysateLane 3: 22ug mouse liver cell lysateLane 4: 22ug mouse liver cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:PLD2Submitted by:Chongben Zhang, UNC, Chapel Hill)

Rabbit PLD2 Polyclonal Antibody | anti-PLD2 antibody

PLD2 antibody - middle region

Gene Names
PLD2; PLD1C
Reactivity
Cow, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLD2; Polyclonal Antibody; PLD2 antibody - middle region; anti-PLD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT
Sequence Length
933
Applicable Applications for anti-PLD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 22ug mouse liver cell lysateLane 2: 22ug mouse liver cell lysateLane 3: 22ug mouse liver cell lysateLane 4: 22ug mouse liver cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:PLD2Submitted by:Chongben Zhang, UNC, Chapel Hill)

Western Blot (WB) (Lanes:Lane 1: 22ug mouse liver cell lysateLane 2: 22ug mouse liver cell lysateLane 3: 22ug mouse liver cell lysateLane 4: 22ug mouse liver cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:PLD2Submitted by:Chongben Zhang, UNC, Chapel Hill)

Western Blot (WB)

(WB Suggested Anti-PLD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-PLD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-PLD2 antibody
This is a rabbit polyclonal antibody against PLD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. Activation of PC-specific PLDs occurs as a consequence of agonist stimulation of both tyrosine kinase and G protein-coupled receptors. PC-specific PLDs have been proposed to function in regulated secretion, cytoskeletal reorganization, transcriptional regulation, and cell cycle control.Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. Activation of PC-specific PLDs occurs as a consequence of agonist stimulation of both tyrosine kinase and G protein-coupled receptors. PC-specific PLDs have been proposed to function in regulated secretion, cytoskeletal reorganization, transcriptional regulation, and cell cycle control.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-14 AF033850.1 61-74 15-614 BC015033.1 1-600 615-1279 BC056871.1 549-1213 1280-1830 BC015033.1 1266-1816 1831-1995 BC056871.1 1765-1929 1996-3489 BC015033.1 1982-3475
Product Categories/Family for anti-PLD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
phospholipase D2 isoform PLD2A
NCBI Official Synonym Full Names
phospholipase D2
NCBI Official Symbol
PLD2
NCBI Official Synonym Symbols
PLD1C
NCBI Protein Information
phospholipase D2
UniProt Protein Name
Phospholipase D2
Protein Family
UniProt Gene Name
PLD2
UniProt Synonym Gene Names
PLD 2; hPLD2
UniProt Entry Name
PLD2_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

PLD2: a phosphatidylcholine-specific phospholipase D. Catalyzes the hydrolysis of PC to produce phosphatidic acid and choline. Activated as a consequence of agonist stimulation of both tyrosine kinase and G protein-coupled receptors. May function in regulated secretion, cytoskeletal reorganization, transcriptional regulation, and cell cycle control. Enriched in caveolae; may be involved in MEK/ERK signaling cascades induced by the VEGF/VEGFR-2/PKC-delta pathway in endothelial cells. Three alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; EC 3.1.4.4; Lipid Metabolism - ether lipid; Lipid Metabolism - glycerophospholipid; Phospholipase

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: endoplasmic reticulum membrane; brush border membrane; plasma membrane

Molecular Function: protein binding; phospholipase D activity; phosphoinositide binding

Biological Process: G-protein coupled receptor internalization; phosphatidylglycerol biosynthetic process; small GTPase mediated signal transduction; phospholipid metabolic process; glycerophospholipid biosynthetic process; innate immune response; phosphatidic acid biosynthetic process; cytoskeleton organization and biogenesis; lipid catabolic process

Research Articles on PLD2

Similar Products

Product Notes

The PLD2 pld2 (Catalog #AAA3201294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLD2 antibody - middle region reacts with Cow, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLD2 pld2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLHYRLTDLG DSSESAASQP PTPRPDSPAT PDLSHNQFFW LGKDYSNLIT. It is sometimes possible for the material contained within the vial of "PLD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.