Western Blot (WB)
(Host: MouseTarget Name: PLCB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Rabbit PLCB1 Polyclonal Antibody | anti-PLCB1 antibody
PLCB1 antibody - middle region
Gene Names
PLCB1; PLC-I; EIEE12; PI-PLC; PLC154; PLCB1A; PLCB1B; PLC-154; PLC-beta-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLCB1; Polyclonal Antibody; PLCB1 antibody - middle region; anti-PLCB1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT
Sequence Length
1173
Applicable Applications for anti-PLCB1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLCB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: PLCB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: PLCB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-PLCB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PLCB1 is expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-PLCB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PLCB1 is expressed in HepG2)
Related Product Information for anti-PLCB1 antibody
This is a rabbit polyclonal antibody against PLCB1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction
Target Description: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction
Product Categories/Family for anti-PLCB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
134kDa
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform b
NCBI Official Synonym Full Names
phospholipase C beta 1
NCBI Official Symbol
PLCB1
NCBI Official Synonym Symbols
PLC-I; EIEE12; PI-PLC; PLC154; PLCB1A; PLCB1B; PLC-154; PLC-beta-1
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
Protein Family
NCBI Description
The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on PLCB1
Similar Products
Product Notes
The PLCB1 (Catalog #AAA3212432) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLCB1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLCB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLCB1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAQSKRQEKL VEKHKEIRQQ ILDEKPKGEG SSSFLSETCH EDPSVSPNFT. It is sometimes possible for the material contained within the vial of "PLCB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
