Western Blot (WB)
(PLB1 polyclonal antibody. Western Blot analysis of PLB1 expression in human colon.)
Mouse anti-Human PLB1 Polyclonal Antibody | anti-PLB1 antibody
PLB1 (Phospholipase B1, Membrane-associated, Phospholipase B, hPLB, Phospholipase B/Lipase, PLB/LIP, PLB, FLJ30866)
Gene Names
PLB1; PLB; hPLB; PLB/LIP
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PLB1; Polyclonal Antibody; PLB1 (Phospholipase B1; Membrane-associated; Phospholipase B; hPLB; Phospholipase B/Lipase; PLB/LIP; PLB; FLJ30866); Anti -PLB1 (Phospholipase B1; anti-PLB1 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PLB1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKLEVREGAEIRCPDKDPSDTVPTSVHRLKPADINVIGALGDSLTAGNGAGSTPGNVLDVLTQYRGLSWSVGGDENIGTVTTLANILREFNPSLKGFSVGTGKETSPNAFLNQAVAGGRAEDLPVQARRLVDLMKNDTRIHFQEDWKIITLFIGGNDLCDFCNDLVHYSPQNFTDNIGKALDILHAEVPRAFVNLVTVLEIVNLRELYQEKKVYCPRMILRSLCPCVLKFDDNSTELATLIEFNKKFQEKTHQLIESGRYDTREDFTVVVQPFFENVDMPKTSEGLPDNSFFAPDCFHFSSKSHSRAASALWNNMLEPVGQKTTRHKFENKINITCPNQVQPFLRTYKNSMQGHGTWLPCRDRAPSALHPTSVHALRPADIQVVAALGDSLTAGNGIGSKPDDLPDVTTQYRGLSYRESKPGFLSDSWVSKSNRKCTRKAPNP
Applicable Applications for anti-PLB1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PLB1, aa1-488 (AAH65041).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(PLB1 polyclonal antibody. Western Blot analysis of PLB1 expression in human colon.)
Western Blot (WB)
(PLB1 polyclonal antibody. Western Blot analysis of PLB1 expression in human colon.)
Western Blot (WB)
(Western Blot analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate (53.68kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate (53.68kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLB1 antibody
Membrane-associated phospholipase. Exhibits a calcium-independent broad substrate specificity including phospholipase A2/lysophospholipase activity. Preferential hydrolysis at the sn-2 position of diacylphospholipids and diacyglycerol, whereas it shows no positional specificity toward triacylglycerol. Exhibits also esterase activity toward p-nitrophenyl. May act on the brush border membrane to facilitate the absorption of digested lipids.
Product Categories/Family for anti-PLB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
163,081 Da
NCBI Official Full Name
PLB1 protein
NCBI Official Synonym Full Names
phospholipase B1
NCBI Official Symbol
PLB1
NCBI Official Synonym Symbols
PLB; hPLB; PLB/LIP
NCBI Protein Information
phospholipase B1, membrane-associated; phospholipase A2; lysophospholipase; phospholipase B/lipase
UniProt Protein Name
Phospholipase B1, membrane-associated
Protein Family
UniProt Gene Name
PLB1
UniProt Synonym Gene Names
PLB; Phospholipase B; hPLB; PLB/LIP
UniProt Entry Name
PLB1_HUMAN
Uniprot Description
PLB1: Membrane-associated phospholipase. Exhibits a calcium- independent broad substrate specificity including phospholipase A2/lysophospholipase activity. Preferential hydrolysis at the sn-2 position of diacylphospholipids and diacyglycerol, whereas it shows no positional specificity toward triacylglycerol. Exhibits also esterase activity toward p-nitrophenyl. May act on the brush border membrane to facilitate the absorption of digested lipids. Belongs to the 'GDSL' lipolytic enzyme family. Phospholipase B1 subfamily. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Phospholipase; EC 3.1.1.5; EC 3.1.1.4
Chromosomal Location of Human Ortholog: 2p23.2
Cellular Component: apical plasma membrane; plasma membrane; integral to membrane
Molecular Function: phospholipase A2 activity; lysophospholipase activity
Biological Process: phototransduction, visible light; phospholipid metabolic process; glycerophospholipid biosynthetic process; retinoid metabolic process; lipid catabolic process
Research Articles on PLB1
Similar Products
Product Notes
The PLB1 plb1 (Catalog #AAA641392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLB1 (Phospholipase B1, Membrane-associated, Phospholipase B, hPLB, Phospholipase B/Lipase, PLB/LIP, PLB, FLJ30866) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PLB1 plb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEPAGEKDEP LSVKHGRPMK CPSQESPYLF SYRNSNYLTR LQKPQDKLEV REGAEIRCPD KDPSDTVPTS VHRLKPADIN VIGALGDSLT AGNGAGSTPG NVLDVLTQYR GLSWSVGGDE NIGTVTTLAN ILREFNPSLK GFSVGTGKET SPNAFLNQAV AGGRAEDLPV QARRLVDLMK NDTRIHFQED WKIITLFIGG NDLCDFCNDL VHYSPQNFTD NIGKALDILH AEVPRAFVNL VTVLEIVNLR ELYQEKKVYC PRMILRSLCP CVLKFDDNST ELATLIEFNK KFQEKTHQLI ESGRYDTRED FTVVVQPFFE NVDMPKTSEG LPDNSFFAPD CFHFSSKSHS RAASALWNNM LEPVGQKTTR HKFENKINIT CPNQVQPFLR TYKNSMQGHG TWLPCRDRAP SALHPTSVHA LRPADIQVVA ALGDSLTAGN GIGSKPDDLP DVTTQYRGLS YRESKPGFLS DSWVSKSNRK CTRKAPNP. It is sometimes possible for the material contained within the vial of "PLB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
