Rabbit anti-Mouse Platelet Factor 4 (PF4) Polyclonal Antibody | anti-PF4 antibody
Polyclonal Antibody to Platelet Factor 4 (PF4)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-V TSAGPEESDG DLSCVCVKTI SSGIHLKHIT SLEVIKAGRH CAVPQLIATL KNGRKICLDR QAPLYKKVIK KILES
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
NCBI and Uniprot Product Information
Uniprot Description
PF4: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form. Belongs to the intercrine alpha (chemokine CxC) family.
Protein type: Apoptosis; Chemokine; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 5|5 E1
Cellular Component: cytoplasm; extracellular region; extracellular space; protein complex; vesicle
Molecular Function: chemokine activity; CXCR chemokine receptor binding; CXCR3 chemokine receptor binding; cytokine activity; heparin binding
Biological Process: chemotaxis; cytokine-mediated signaling pathway; defense response; defense response to protozoan; G-protein coupled receptor signaling pathway; immune response; inflammatory response; killing by host of symbiont cells; leukocyte chemotaxis; negative regulation of angiogenesis; negative regulation of cytolysis; negative regulation of megakaryocyte differentiation; negative regulation of MHC class II biosynthetic process; platelet activation; positive regulation of cAMP metabolic process; positive regulation of macrophage differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of tumor necrosis factor production; protein complex assembly; regulation of cell proliferation; response to lipopolysaccharide
Research Articles on PF4
Similar Products
Product Notes
The PF4 pf4 (Catalog #AAA2005948) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Platelet Factor 4 (PF4) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Platelet Factor 4 (PF4) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the PF4 pf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-V TSAGPEESDG DLSCVCVKTI SSGIHLKHIT SLEVIKAGRH CAVPQLIATL KNGRKICLDR QAPLYKKVIK KILES. It is sometimes possible for the material contained within the vial of "Platelet Factor 4 (PF4), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.