Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PKN2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellPKN2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit PKN2 Polyclonal Antibody | anti-PKN2 antibody

PKN2 antibody - C-terminal region

Gene Names
PKN2; PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042
Reactivity
Cow, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PKN2; Polyclonal Antibody; PKN2 antibody - C-terminal region; anti-PKN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL
Sequence Length
984
Applicable Applications for anti-PKN2 antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PKN2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellPKN2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-PKN2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellPKN2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-PKN2 antibody
This is a rabbit polyclonal antibody against PKN2. It was validated on Western Blot

Target Description: PKN2 exhibits a preference for highly basic protein substrates.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108kDa
NCBI Official Full Name
serine/threonine-protein kinase N2 isoform 1
NCBI Official Synonym Full Names
protein kinase N2
NCBI Official Symbol
PKN2
NCBI Official Synonym Symbols
PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042
NCBI Protein Information
serine/threonine-protein kinase N2
UniProt Protein Name
Serine/threonine-protein kinase N2
UniProt Gene Name
PKN2
UniProt Synonym Gene Names
PRK2; PRKCL2
UniProt Entry Name
PKN2_HUMAN

Uniprot Description

PKN2: an AGC kinase of the PKN family. A PKC-related serine/threonine-protein kinase and Rho/Rac effector protein. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcriptional activation. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in an ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF). Phosphorylates HCV NS5B leading to stimulation of HCV RNA replication. Kinase activity is activated upon binding to GTP-bound Rhoa/Rac1 GTPases. Activated by limited proteolysis with trypsin, and withn caspase-3 (CASP3) during apoptosis. Activated by lipids, particularly cardiolipin and to a lesser extent by other acidic phospholipids and unsaturated fatty acids. Colocalizes with PTPN13 in lamellipodia-like structures, regions of large actin turnover. Accumulates during telophase at the cleavage furrow and concentrates finally around the midbody in cytokinesis. Recruited to nascent cell-cell contacts at the apical surface of cells. In the course of viral infection, colocalizes with HCV NS5B at perinuclear region in the cytoplasm. Five isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.13; Protein kinase, AGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); AGC group; PKN family

Chromosomal Location of Human Ortholog: 1p22.2

Cellular Component: nucleoplasm; apical junction complex; centrosome; intermediate filament cytoskeleton; lamellipodium; perinuclear region of cytoplasm; cytoplasm; plasma membrane; midbody; cell junction; nucleus; cleavage furrow

Molecular Function: protein serine/threonine kinase activity; protein binding; protein kinase C activity; histone deacetylase binding; kinase activity; ATP binding; protein kinase activity

Biological Process: positive regulation of cytokinesis; positive regulation of viral genome replication; apical junction assembly; transcription, DNA-dependent; regulation of transcription, DNA-dependent; cell division; apoptosis; positive regulation of mitotic cell cycle; signal transduction; cell adhesion; cell cycle; protein amino acid phosphorylation

Research Articles on PKN2

Similar Products

Product Notes

The PKN2 pkn2 (Catalog #AAA3215389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PKN2 antibody - C-terminal region reacts with Cow, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PKN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PKN2 pkn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVFDIQNDRN SILPKSQSEY KPDTPQSGLE YSGIQELEDR RSQQRFQFNL. It is sometimes possible for the material contained within the vial of "PKN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.