Mouse anti-Human PRK2 Monoclonal Antibody | anti-PRK2 antibody

PRK2 (Serine/Threonine-protein Kinase N2, PKN gamma, Protein Kinase C-like 2, Protein-kinase C-related Kinase 2, PKN2, PRKCL2, MGC150606, MGC71074) (HRP)

Cat. Num. AAA6154334

• Gene Names: PKN2; PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRK2; Monoclonal Antibody; PRK2 (Serine/Threonine-protein Kinase N2; PKN gamma; Protein Kinase C-like 2; Protein-kinase C-related Kinase 2; PKN2; PRKCL2; MGC150606; MGC71074) (HRP); anti-PRK2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A7
• Specificity: Recognizes human PKN2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PRK2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa580-679, from human PKN2 (NP_006247) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PKN2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PKN2 is ~0.1mg/ml as a capture antibody.)

Related Product Information for anti-PRK2 antibody

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The AGC kinase group consists of 63 kinases including the cyclic nucleotide-regulated protein kinase (PKA & PKG) family, the diacylglycerol-activated/phospholipid-dependent protein kinase C (PKC) family, the related to PKA and PKC (RAC/Akt) protein kinase family, the kinases that phosphorylate G protein-coupled receptors family (ARK), and the kinases that phosphorylate ribosomal protein S6 family (RSK) The calcium/calmodulin-dependent kinase (CAMK) group consists of 75 kinases regulated by Ca2+/CaM and close relative family (CAMK, CAMKL, DAPK, MAPKAPK).

Product Categories/Family for anti-PRK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5453974
• NCBI GeneID: 5586
• NCBI Accession #: NP_006247
• NCBI GenBank Nucleotide #: NM_006256
• UniProt Accession #: Q16513; Q08AF4; Q9H1W4; B4DQ21; B4DTP5; B4DVG1; D3DT24
• Molecular Weight: 75,171 Da
• NCBI Official Full Name: serine/threonine-protein kinase N2
• NCBI Official Synonym Full Names: protein kinase N2
• NCBI Official Symbol: PKN2
• NCBI Official Synonym Symbols: PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042
• NCBI Protein Information: serine/threonine-protein kinase N2; PKN gamma; cardiolipin-activated protein kinase Pak2; protein kinase C-like 2; protein-kinase C-related kinase 2
• UniProt Protein Name: Serine/threonine-protein kinase N2
• Protein Family: Pollen receptor-like kinase
• UniProt Gene Name: PKN2
• UniProt Synonym Gene Names: PRK2; PRKCL2
• UniProt Entry Name: PKN2_HUMAN

Uniprot Description

PKN2: an AGC kinase of the PKN family. A PKC-related serine/threonine-protein kinase and Rho/Rac effector protein. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcriptional activation. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in an ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF). Phosphorylates HCV NS5B leading to stimulation of HCV RNA replication. Kinase activity is activated upon binding to GTP-bound Rhoa/Rac1 GTPases. Activated by limited proteolysis with trypsin, and withn caspase-3 (CASP3) during apoptosis. Activated by lipids, particularly cardiolipin and to a lesser extent by other acidic phospholipids and unsaturated fatty acids. Colocalizes with PTPN13 in lamellipodia-like structures, regions of large actin turnover. Accumulates during telophase at the cleavage furrow and concentrates finally around the midbody in cytokinesis. Recruited to nascent cell-cell contacts at the apical surface of cells. In the course of viral infection, colocalizes with HCV NS5B at perinuclear region in the cytoplasm. Five isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.13; Protein kinase, AGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); AGC group; PKN family

Chromosomal Location of Human Ortholog: 1p22.2

Cellular Component: nucleoplasm; apical junction complex; centrosome; intermediate filament cytoskeleton; lamellipodium; perinuclear region of cytoplasm; cytoplasm; plasma membrane; midbody; cell junction; nucleus; cleavage furrow

Molecular Function: protein serine/threonine kinase activity; protein binding; protein kinase C activity; histone deacetylase binding; kinase activity; ATP binding; protein kinase activity

Biological Process: positive regulation of cytokinesis; positive regulation of viral genome replication; apical junction assembly; transcription, DNA-dependent; regulation of transcription, DNA-dependent; cell division; apoptosis; positive regulation of mitotic cell cycle; signal transduction; cell adhesion; cell cycle; protein amino acid phosphorylation