Western Blot (WB)
(Host: RabbitTarget Name: PKDCCSample Tissue: Human Fetal Brain lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PKDCC Polyclonal Antibody | anti-PKDCC antibody
PKDCC Antibody - N-terminal region
Gene Names
PKDCC; Vlk; SGK493
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PKDCC; Polyclonal Antibody; PKDCC Antibody - N-terminal region; anti-PKDCC antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGRGELARQIRARYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLPRP
Sequence Length
493
Applicable Applications for anti-PKDCC antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 78%; Human: 100%; Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PKDCC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PKDCCSample Tissue: Human Fetal Brain lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PKDCCSample Tissue: Human Fetal Brain lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PKDCC antibody
protein kinase domain containing, cytoplasmic homolog (mouse)
Target Description: Secreted tyrosine-protein kinase that mediates phosphorylation of extracellular proteins and endogenous proteins in the secretory pathway, which is essential for patterning at organogenesis stages. Mediates phosphorylation of MMP1, MMP13, MMP14, MMP19 and ERP29. Probably plays a role in platelets: rapidly and quantitatively secreted from platelets in response to stimulation of platelet degranulation. May also have serine/threonine protein kinase activity. Required for longitudinal bone growth through regulation of chondrocyte differentiation. May be indirectly involved in protein transport from the Golgi apparatus to the plasma membrane.
Target Description: Secreted tyrosine-protein kinase that mediates phosphorylation of extracellular proteins and endogenous proteins in the secretory pathway, which is essential for patterning at organogenesis stages. Mediates phosphorylation of MMP1, MMP13, MMP14, MMP19 and ERP29. Probably plays a role in platelets: rapidly and quantitatively secreted from platelets in response to stimulation of platelet degranulation. May also have serine/threonine protein kinase activity. Required for longitudinal bone growth through regulation of chondrocyte differentiation. May be indirectly involved in protein transport from the Golgi apparatus to the plasma membrane.
Product Categories/Family for anti-PKDCC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
extracellular tyrosine-protein kinase PKDCC
NCBI Official Synonym Full Names
protein kinase domain containing, cytoplasmic
NCBI Official Symbol
PKDCC
NCBI Official Synonym Symbols
Vlk; SGK493
NCBI Protein Information
extracellular tyrosine-protein kinase PKDCC
UniProt Protein Name
Extracellular tyrosine-protein kinase PKDCC
Protein Family
UniProt Gene Name
PKDCC
UniProt Entry Name
PKDCC_HUMAN
Uniprot Description
PKDCC: Protein kinase which is required for longitudinal bone growth through regulation of chondrocyte differentiation. Involved in protein transport from the Golgi apparatus to the plasma membrane. Belongs to the protein kinase superfamily.
Protein type: Kinase, protein; Protein kinase, Other; EC 2.7.10.2; Other group; SgK493 family
Chromosomal Location of Human Ortholog: 2p21
Cellular Component: Golgi apparatus; extracellular region
Molecular Function: non-membrane spanning protein tyrosine kinase activity; ATP binding; protein kinase activity
Biological Process: protein transport; positive regulation of chondrocyte differentiation; peptidyl-tyrosine phosphorylation; negative regulation of Golgi to plasma membrane protein transport; multicellular organism growth; palate development; positive regulation of bone mineralization; cell differentiation; alveolus development; embryonic gut development; skeletal development; bone mineralization
Research Articles on PKDCC
Similar Products
Product Notes
The PKDCC pkdcc (Catalog #AAA3215787) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PKDCC Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PKDCC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PKDCC pkdcc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGRGELARQI RARYEEVQRY SRGGPGPGAG RPERRRLMDL APGGPGLPRP. It is sometimes possible for the material contained within the vial of "PKDCC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
