Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GIT2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GIT2 Polyclonal Antibody | anti-GIT2 antibody

GIT2 Antibody - middle region

Gene Names
GIT2; PKL; CAT2; CAT-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GIT2; Polyclonal Antibody; GIT2 Antibody - middle region; anti-GIT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDS
Sequence Length
759
Applicable Applications for anti-GIT2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GIT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GIT2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GIT2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GIT2 antibody
This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83 kDa
NCBI Official Full Name
ARF GTPase-activating protein GIT2 isoform 6
NCBI Official Synonym Full Names
GIT ArfGAP 2
NCBI Official Symbol
GIT2
NCBI Official Synonym Symbols
PKL; CAT2; CAT-2
NCBI Protein Information
ARF GTPase-activating protein GIT2
UniProt Protein Name
ARF GTPase-activating protein GIT2
UniProt Gene Name
GIT2
UniProt Synonym Gene Names
KIAA0148; ARF GAP GIT2; CAT-2; CAT2
UniProt Entry Name
GIT2_HUMAN

NCBI Description

This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. [provided by RefSeq, Sep 2008]

Uniprot Description

GIT2: possesses ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. Interacts with G protein-coupled receptor kinases. Associates with paxillin. Also interacts with PIX exchange factors. Regulates Golgi and actin cytoskeletal organization. Important in integrin-mediated cell adhesion. Ten alternatively spliced isoforms have been described and additional isoforms seem to exist. Contains 1 Arf-GAP domain and 3 ANK repeats.

Protein type: GAPs, ARF; Motility/polarity/chemotaxis; GAPs

Chromosomal Location of Human Ortholog: 12q24.1

Cellular Component: nucleoplasm; focal adhesion

Molecular Function: protein binding; zinc ion binding

Biological Process: behavioral response to pain; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity

Research Articles on GIT2

Similar Products

Product Notes

The GIT2 git2 (Catalog #AAA3222519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIT2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GIT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIT2 git2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VELILKTINN QHSVESQDND QPDYDSVASD EDTDLETTAS KTNRQKSLDS. It is sometimes possible for the material contained within the vial of "GIT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.