Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DYNC2LI1Sample Tissue: Human Fetal KidneyAntibody Dilution: 1ug/ml)

Rabbit DYNC2LI1 Polyclonal Antibody | anti-DYNC2LI1 antibody

DYNC2LI1 Antibody - N-terminal region

Gene Names
DYNC2LI1; LIC3; D2LIC; CGI-60
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DYNC2LI1; Polyclonal Antibody; DYNC2LI1 Antibody - N-terminal region; anti-DYNC2LI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI
Sequence Length
201
Applicable Applications for anti-DYNC2LI1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DYNC2LI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DYNC2LI1Sample Tissue: Human Fetal KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DYNC2LI1Sample Tissue: Human Fetal KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-DYNC2LI1 antibody
This is a rabbit polyclonal antibody against DYNC2LI1. It was validated on Western Blot

Target Description: DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis.
Product Categories/Family for anti-DYNC2LI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
cytoplasmic dynein 2 light intermediate chain 1 isoform 4
NCBI Official Synonym Full Names
dynein cytoplasmic 2 light intermediate chain 1
NCBI Official Symbol
DYNC2LI1
NCBI Official Synonym Symbols
LIC3; D2LIC; CGI-60
NCBI Protein Information
cytoplasmic dynein 2 light intermediate chain 1
UniProt Protein Name
Cytoplasmic dynein 2 light intermediate chain 1
Protein Family
UniProt Gene Name
DYNC2LI1
UniProt Synonym Gene Names
D2LIC; LIC3; CGI-60; Dynein 2 light intermediate chain
UniProt Entry Name
DC2L1_HUMAN

NCBI Description

This gene encodes a protein that is a component of the dynein-2 microtubule motor protein complex that plays a role in the retrograde transport of cargo in primary cilia via the intraflagellar transport system. This gene is ubiquitously expressed and its protein, which localizes to the axoneme and Golgi apparatus, interacts directly with the cytoplasmic dynein 2 heavy chain 1 protein to form part of the multi-protein dynein-2 complex. Mutations in this gene produce defects in the dynein-2 complex which result in several types of ciliopathy including short-rib thoracic dysplasia 15 with polydactyly (SRTD15). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2017]

Research Articles on DYNC2LI1

Similar Products

Product Notes

The DYNC2LI1 dync2li1 (Catalog #AAA3219313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYNC2LI1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DYNC2LI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DYNC2LI1 dync2li1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDRDEPPKPT LALEYTYGRR AKGHNTPKDI AHFWELGGGT SLLDLISIPI. It is sometimes possible for the material contained within the vial of "DYNC2LI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.