Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATG14Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ATG14 Polyclonal Antibody | anti-ATG14 antibody

ATG14 Antibody - middle region

Gene Names
ATG14; ATG14L; BARKOR; KIAA0831
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATG14; Polyclonal Antibody; ATG14 Antibody - middle region; anti-ATG14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
Sequence Length
492
Applicable Applications for anti-ATG14 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATG14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATG14Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATG14Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATG14 antibody
Required for both basal and inducible autophagy. Determines the localization of the autophagy-specific PI3-kinase complex PI3KC3-C1. Plays a role in autophagosome formation and MAP1LC3/LC3 conjugation to phosphatidylethanolamine. Promotes BECN1 translocation from the trans-Golgi network to autophagosomes. Enhances PIK3C3 activity in a BECN1-dependent manner. Essential for the autophagy-dependent phosphorylation of BECN1. Stimulates the phosphorylation of BECN1, but suppresses the phosphorylation PIK3C3 by AMPK. Binds to STX17-SNAP29 binary t-SNARE complex on autophagosomes and primes it for VAMP8 interaction to promote autophagosome-endolysosome fusion. Modulates the hepatic lipid metabolism.
Product Categories/Family for anti-ATG14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
beclin 1-associated autophagy-related key regulator
NCBI Official Synonym Full Names
autophagy related 14
NCBI Official Symbol
ATG14
NCBI Official Synonym Symbols
ATG14L; BARKOR; KIAA0831
NCBI Protein Information
beclin 1-associated autophagy-related key regulator
UniProt Protein Name
Beclin 1-associated autophagy-related key regulator
Protein Family
UniProt Gene Name
ATG14
UniProt Synonym Gene Names
KIAA0831; Barkor; Atg14L
UniProt Entry Name
BAKOR_HUMAN

Uniprot Description

Barkor: Required for both basal and inducible autophagy. Plays a role in autophagosome formation and MAP1LC3/LC3 conjugation to phosphatidylethanolamine. Promotes BECN1 translocation from the trans-Golgi network to autophagosomes. Enhances PIK3C3 activity in a BECN1-dependent manner. Forms a complex with BECN1, PIK3C3 and PIK3R4, but not with UVRAG, nor with KIAA0226/Rubicon. UVRAG and ATG14/Barkor form mutually exclusive complexes with BECN1 through direct competition. The complex containing ATG14 up-regulates autophagy, while the one containing Rubicon down-regulates autophagy. Interacts with PIK3CB. Belongs to the Barkor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 14q22.3

Cellular Component: nucleoplasm; cytoplasm; pre-autophagosomal structure membrane; autophagic vacuole; phagocytic vesicle; axoneme; nucleus

Molecular Function: protein binding

Biological Process: regulation of protein amino acid phosphorylation; macroautophagy; mitochondrion degradation; endosome to lysosome transport; positive regulation of autophagy; autophagic vacuole formation

Research Articles on ATG14

Similar Products

Product Notes

The ATG14 atg14 (Catalog #AAA3221701) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG14 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG14 atg14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEEMEKNSEG LLKTKEKNQK LYSRAQRHQE KKEKIQRHNR KLGDLVEKKT. It is sometimes possible for the material contained within the vial of "ATG14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.