Rabbit anti-Human PITPNM3 Polyclonal Antibody | anti-PITPNM3 antibody

PITPNM3 Antibody - C-terminal region

Cat. Num. AAA3220930

• Gene Names: PITPNM3; NIR1; ACKR6; CORD5; RDGBA3
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PITPNM3; Polyclonal Antibody; PITPNM3 Antibody - C-terminal region; anti-PITPNM3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
• Sequence: Synthetic peptide located within the following region: FLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWAR
• Sequence Length: 565

• Applicable Applications for anti-PITPNM3 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PITPNM3
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PITPNM3Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-PITPNM3 antibody

This gene encodes a member of a family of membrane-associated phosphatidylinositol transfer domain-containing proteins. The calcium-binding protein has phosphatidylinositol (PI) transfer activity and interacts with the protein tyrosine kinase PTK2B (also known as PYK2). The protein is homologous to a Drosophila protein that is implicated in the visual transduction pathway in flies. Mutations in this gene result in autosomal dominant cone dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-PITPNM3 antibody

Polyclonal; Ion Channel; Transcription Regulation; Membrane Protein; Drosophilia Transcription Factors; Membrane & Traffic; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 190358515
• NCBI GeneID: 83394
• NCBI Accession #: NP_112497.2
• NCBI GenBank Nucleotide #: NM_031220.3
• UniProt Accession #: Q9BZ71
• Molecular Weight: 62 kDa
• NCBI Official Full Name: membrane-associated phosphatidylinositol transfer protein 3 isoform 1
• NCBI Official Synonym Full Names: PITPNM family member 3
• NCBI Official Symbol: PITPNM3
• NCBI Official Synonym Symbols: NIR1; ACKR6; CORD5; RDGBA3
• NCBI Protein Information: membrane-associated phosphatidylinositol transfer protein 3
• UniProt Protein Name: Membrane-associated phosphatidylinositol transfer protein 3
• Protein Family: Membrane-associated phosphatidylinositol transfer protein
• UniProt Gene Name: PITPNM3
• UniProt Synonym Gene Names: NIR1; PITPnm 3; NIR-1
• UniProt Entry Name: PITM3_HUMAN

NCBI Description

This gene encodes a member of a family of membrane-associated phosphatidylinositol transfer domain-containing proteins. The calcium-binding protein has phosphatidylinositol (PI) transfer activity and interacts with the protein tyrosine kinase PTK2B (also known as PYK2). The protein is homologous to a Drosophila protein that is implicated in the visual transduction pathway in flies. Mutations in this gene result in autosomal dominant cone dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]

Uniprot Description

PITPNM3: transfers phosphatidylinositol and phosphatidylcholine between membranes. Binds calcium ions. Interacts with Pyk2 via its C-terminus. Two splice-variant isoforms have been described.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: integral to membrane; endomembrane system; intracellular

Molecular Function: protein binding; phosphatidylinositol transporter activity; calcium ion binding; receptor tyrosine kinase binding; lipid binding

Biological Process: phospholipid transport; phosphatidylinositol metabolic process

Disease: Cone-rod Dystrophy 5