Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DLGAP4Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DLGAP4 Polyclonal Antibody | anti-DLGAP4 antibody

DLGAP4 Antibody - middle region

Gene Names
DLGAP4; DAP4; DLP4; DAP-4; SAPAP4; SAPAP-4
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DLGAP4; Polyclonal Antibody; DLGAP4 Antibody - middle region; anti-DLGAP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSI
Sequence Length
992
Applicable Applications for anti-DLGAP4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DLGAP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DLGAP4Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DLGAP4Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DLGAP4 antibody
The product of this gene is a membrane-associated guanylate kinase found at the postsynaptic density in neuronal cells. It is a signaling molecule that can interact with potassium channels and receptors, as well as other signaling molecules. The protein encoded by this gene can interact with PSD-95 through its guanylate kinase domain and may be involved in clustering PSD-95 in the postsynaptic density region. The encoded protein is one of at least four similar proteins that have been found. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109 kDa
NCBI Official Full Name
disks large-associated protein 4 isoform c
NCBI Official Synonym Full Names
DLG associated protein 4
NCBI Official Symbol
DLGAP4
NCBI Official Synonym Symbols
DAP4; DLP4; DAP-4; SAPAP4; SAPAP-4
NCBI Protein Information
disks large-associated protein 4
UniProt Protein Name
Disks large-associated protein 4
UniProt Gene Name
DLGAP4
UniProt Synonym Gene Names
DAP4; KIAA0964; SAPAP4; DAP-4; SAPAP-4
UniProt Entry Name
DLGP4_HUMAN

NCBI Description

The product of this gene is a membrane-associated guanylate kinase found at the postsynaptic density in neuronal cells. It is a signaling molecule that can interact with potassium channels and receptors, as well as other signaling molecules. The protein encoded by this gene can interact with PSD-95 through its guanylate kinase domain and may be involved in clustering PSD-95 in the postsynaptic density region. The encoded protein is one of at least four similar proteins that have been found. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SAPAP4: May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane. Belongs to the SAPAP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, peripheral; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 20q11.23

Cellular Component: membrane; synapse

Molecular Function: protein binding

Biological Process: cell-cell signaling

Research Articles on DLGAP4

Similar Products

Product Notes

The DLGAP4 dlgap4 (Catalog #AAA3222913) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLGAP4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLGAP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLGAP4 dlgap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVEDDWRSSV PSHSMSSRRD TDSDTQDAND SSCKSSERSL PDCTPHPNSI. It is sometimes possible for the material contained within the vial of "DLGAP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.