Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CLCKBSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CLCNKB Polyclonal Antibody | anti-CLCNKB antibody

CLCNKB Antibody - C-terminal region

Gene Names
CLCNKB; CLCKB; ClC-K2; ClC-Kb
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CLCNKB; Polyclonal Antibody; CLCNKB Antibody - C-terminal region; anti-CLCNKB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEPV
Sequence Length
687
Applicable Applications for anti-CLCNKB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLCKB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CLCKBSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CLCKBSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CLCNKB antibody
This is a rabbit polyclonal antibody against CLCKB. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the family of voltage-gated chloride channels. Chloride channels have several functions, including the regulation of cell volume, membrane potential stabilization, signal transduction and transepithelial transport. This gene is expressed predominantly in the kidney and may be important for renal salt reabsorption. Mutations in this gene are associated with autosomal recessive Bartter syndrome type 3 (BS3). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
chloride channel protein ClC-Kb isoform 2
NCBI Official Synonym Full Names
chloride voltage-gated channel Kb
NCBI Official Symbol
CLCNKB
NCBI Official Synonym Symbols
CLCKB; ClC-K2; ClC-Kb
NCBI Protein Information
chloride channel protein ClC-Kb
UniProt Protein Name
Chloride channel protein ClC-Kb
Protein Family
UniProt Gene Name
CLCNKB
UniProt Synonym Gene Names
Chloride channel Kb
UniProt Entry Name
CLCKB_HUMAN

NCBI Description

The protein encoded by this gene is a member of the family of voltage-gated chloride channels. Chloride channels have several functions, including the regulation of cell volume, membrane potential stabilization, signal transduction and transepithelial transport. This gene is expressed predominantly in the kidney and may be important for renal salt reabsorption. Mutations in this gene are associated with autosomal recessive Bartter syndrome type 3 (BS3). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

Function: Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport. May be important in urinary concentrating mechanisms. Ref.6

Subunit structure: Interacts with BSND. Forms heteromers with BSND in the thick ascending limb of Henle and more distal segments

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Tissue specificity: Expressed predominantly in the kidney. Ref.6

Involvement in disease: Bartter syndrome 3 (BS3) [MIM:607364]: An autosomal recessive disorder characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.9Bartter syndrome 4B (BS4B) [MIM:613090]: A digenic, recessive disorder characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. Bartter syndrome type 4B is associated with sensorineural deafness.Note: The disease is caused by mutations affecting distinct genetic loci, including the gene represented in this entry. Loss-of-function of both CLCNKA and CLCNKB results in the disease phenotype (Ref.8). Ref.7 Ref.8

Miscellaneous: Compared with CLCNKA/BSND, CLCNKB/BSND is more sensitive to pH and less responsive to Ca2+.

Sequence similarities: Belongs to the chloride channel (TC 2.A.49) family. CLCNKB subfamily. [View classification]Contains 2 CBS domains.

Research Articles on CLCNKB

Similar Products

Product Notes

The CLCNKB clcnkb (Catalog #AAA3220204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLCNKB Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLCNKB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLCNKB clcnkb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VESTESQILV GIVRRAQLVQ ALKAEPPSWA PGHQQCLQDI LAAGCPTEPV. It is sometimes possible for the material contained within the vial of "CLCNKB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.