Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PIBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysatePIBF1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit PIBF1 Polyclonal Antibody | anti-PIBF1 antibody

PIBF1 antibody - C-terminal region

Gene Names
PIBF1; PIBF; CEP90; JBTS33; C13orf24
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIBF1; Polyclonal Antibody; PIBF1 antibody - C-terminal region; anti-PIBF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
RKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQL
Applicable Applications for anti-PIBF1 antibody
Western Blot (WB)
Protein Size (# AA)
757 amino acids
Protein Interactions
UBC; SAV1; APP; Ndc80; MAP3K2;
Blocking Peptide
For anti-PIBF1 (MBS3210637) antibody is Catalog # MBS3235592
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PIBF1
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PIBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysatePIBF1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-PIBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysatePIBF1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-PIBF1 antibody
PIBF1 is the mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling NK activity exerts an anti-abortive effect.
Product Categories/Family for anti-PIBF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
progesterone-induced-blocking factor 1 isoform 2
NCBI Official Synonym Full Names
progesterone immunomodulatory binding factor 1
NCBI Official Symbol
PIBF1
NCBI Official Synonym Symbols
PIBF; CEP90; JBTS33; C13orf24
NCBI Protein Information
progesterone-induced-blocking factor 1
UniProt Protein Name
Progesterone-induced-blocking factor 1
UniProt Gene Name
PIBF1
UniProt Synonym Gene Names
C13orf24; PIBF
UniProt Entry Name
PIBF1_HUMAN

NCBI Description

This gene encodes a protein that is induced by the steroid hormone progesterone and plays a role in the maintenance of pregnancy. The encoded protein regulates multiple facets of the immune system to promote normal pregnancy including cytokine synthesis, natural killer (NK) cell activity, and arachidonic acid metabolism. Low serum levels of this protein have been associated with spontaneous pre-term labor in humans. This protein may promote the proliferation, migration and invasion of glioma. [provided by RefSeq, Mar 2017]

Uniprot Description

PIBF1: Mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling NK activity exerts an anti-abortive effect. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 13q22.1

Cellular Component: centrosome

Molecular Function: protein binding

Research Articles on PIBF1

Similar Products

Product Notes

The PIBF1 pibf1 (Catalog #AAA3210637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIBF1 antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PIBF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIBF1 pibf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RKDQVTQLSQ ELDRANSLLN QTQQPYRYLI ESVRQRDSKI DSLTESIAQL. It is sometimes possible for the material contained within the vial of "PIBF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.