Western Blot (WB)
(PI4K2A polyclonal antibody. Western Blot analysis of PI4K2A expression in HepG2.)
Mouse anti-Human PI4K2A Polyclonal Antibody | anti-PI4K2A antibody
PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha, Phosphatidylinositol 4-kinase Type II-alpha, DKFZp761G1923, PI4KII, PIK42A, RP11-548K23.6)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PI4K2A; Polyclonal Antibody; PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha; Phosphatidylinositol 4-kinase Type II-alpha; DKFZp761G1923; PI4KII; PIK42A; RP11-548K23.6); Anti -PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha; anti-PI4K2A antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PI4KII.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
Applicable Applications for anti-PI4K2A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PI4KII, aa1-479 (NP_060895.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(PI4K2A polyclonal antibody. Western Blot analysis of PI4K2A expression in HepG2.)
Western Blot (WB)
(PI4K2A polyclonal antibody. Western Blot analysis of PI4K2A expression in HepG2.)
Western Blot (WB)
(Western Blot analysis of PI4KII expression in transfected 293T cell line by PI4KII polyclonal antibody. Lane 1: PI4KII transfected lysate (52.69kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PI4KII expression in transfected 293T cell line by PI4KII polyclonal antibody. Lane 1: PI4KII transfected lysate (52.69kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PI4K2A antibody
Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs. PI4K II is activated by detergent and inhibited by adenosine. Overexpression of PI4KII in COS-7 cells increases synthesis of PtdIns4P. Some cells overexpressing PI4KII have scattered or no perinuclear Golgi. Knockdown of PI4KII by RNA interference (RNAi) does not disrupt the Golgi, and some cells show expanded Golgi. RNAi reduces the Golgi level of PtdIns4P and blocks the association between AP1 and the trans-Golgi network. PI4KII RNAi had little effect on intra-Golgi trafficking, but it inhibited export to plasma membrane export by 35%. It has been proposed that PI4KII generates PtdIns4P-rich domains within the Golgi that specify docking of the AP1 coat machinery.
Product Categories/Family for anti-PI4K2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
phosphatidylinositol 4-kinase type 2-alpha
NCBI Official Synonym Full Names
phosphatidylinositol 4-kinase type 2 alpha<
NCBI Official Symbol
PI4K2A
NCBI Protein Information
phosphatidylinositol 4-kinase type 2-alpha
Protein Family
Similar Products
Product Notes
The PI4K2A (Catalog #AAA6004697) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha, Phosphatidylinositol 4-kinase Type II-alpha, DKFZp761G1923, PI4KII, PIK42A, RP11-548K23.6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PI4K2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PI4K2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDETSPLVSP ERAQPPDYTF PSGSGAHFPQ VPGGAVRVAA AAGSGPSPPG SPGHDRERQP LLDRARGAAA QGQTQTVAAQ AQALAAQAAA AAHAAQAHRE RNEFPEDPEF EAVVRQAELA IERCIFPERI YQGSSGSYFV KDPQGRIIAV FKPKNEEPYG HLNPKWTKWL QKLCCPCCFG RDCLVLNQGY LSEAGASLVD QKLELNIVPR TKVVYLASET FNYSAIDRVK SRGKRLALEK VPKVGQRFNR IGLPPKVGSF QLFVEGYKDA DYWLRRFEAE PLPENTNRQL LLQFERLVVL DYIIRNTDRG NDNWLIKYDC PMDSSSSRDT DWVVVKEPVI KVAAIDNGLA FPLKHPDSWR AYPFYWAWLP QAKVPFSQEI KDLILPKISD PNFVKDLEED LYELFKKDPG FDRGQFHKQI AVMRGQILNL TQALKDNKSP LHLVQMPPVI VETARSHQRS SSESYTQSFQ SRKPFFSWW. It is sometimes possible for the material contained within the vial of "PI4K2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
