Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PI4K2A expression in transfected 293T cell line by PI4K2A polyclonal antibody. Lane 1: PI4K2A transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PI4K2A Polyclonal Antibody | anti-PI4K2A antibody

PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha, Phosphatidylinositol 4-kinase Type II-alpha, DKFZp761G1923, PI4KII, PIK42A, RP11-548K23.6) (AP)

Gene Names
PI4K2A; PI4KII; PIK42A; DKFZp761G1923; RP11-548K23.6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PI4K2A; Polyclonal Antibody; PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha; Phosphatidylinositol 4-kinase Type II-alpha; DKFZp761G1923; PI4KII; PIK42A; RP11-548K23.6) (AP); anti-PI4K2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PI4K2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PI4K2A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PI4K2A, aa1-479 (NP_060895.1).
Immunogen Sequence
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PI4K2A expression in transfected 293T cell line by PI4K2A polyclonal antibody. Lane 1: PI4K2A transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PI4K2A expression in transfected 293T cell line by PI4K2A polyclonal antibody. Lane 1: PI4K2A transfected lysate (54kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PI4K2A antibody
Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo-and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs. PI4K II is activated by detergent and inhibited by adenosine. Overexpression of PI4KII in COS-7 cells increases synthesis of PtdIns4P. Some cells overexpressing PI4KII have scattered or no perinuclear Golgi. Knockdown of PI4KII by RNA interference (RNAi) does not disrupt the Golgi, and some cells show expanded Golgi. RNAi reduces the Golgi level of PtdIns4P and blocks the association between AP1 and the trans-Golgi network. PI4KII RNAi had little effect on intra-Golgi trafficking, but it inhibited export to plasma membrane export by 35%. It has been proposed that PI4KII generates PtdIns4P-rich domains within the Golgi that specify docking of the AP1 coat machinery.
Product Categories/Family for anti-PI4K2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,022 Da
NCBI Official Full Name
phosphatidylinositol 4-kinase type 2-alpha
NCBI Official Synonym Full Names
phosphatidylinositol 4-kinase type 2 alpha
NCBI Official Symbol
PI4K2A
NCBI Official Synonym Symbols
PI4KII; PIK42A; DKFZp761G1923; RP11-548K23.6
NCBI Protein Information
phosphatidylinositol 4-kinase type 2-alpha; OTTHUMP00000020224; OTTHUMP00000221793; phosphatidylinositol 4-kinase type II-alpha; phosphatidylinositol 4-kinase type II (PI4KII)
UniProt Protein Name
Phosphatidylinositol 4-kinase type 2-alpha
UniProt Gene Name
PI4K2A

NCBI Description

Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs (Barylko et al., 2001 [PubMed 11244087]).[supplied by OMIM]

Uniprot Description

PI4K2A: Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells. Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

Protein type: EC 2.7.1.67; Kinase, lipid; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q24.2

Cellular Component: cell soma; cytoplasmic vesicle; cytosol; dendrite; endosome; integral to plasma membrane; intrinsic to membrane; lipid raft; lysosomal membrane; membrane; mitochondrion; neuron projection; plasma membrane; presynaptic membrane; trans-Golgi network

Molecular Function: 1-phosphatidylinositol 4-kinase activity; ATP binding; protein binding

Biological Process: endosome organization and biogenesis; Golgi organization and biogenesis; phosphatidylinositol biosynthetic process; phosphoinositide phosphorylation

Research Articles on PI4K2A

Similar Products

Product Notes

The PI4K2A pi4k2a (Catalog #AAA6389383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha, Phosphatidylinositol 4-kinase Type II-alpha, DKFZp761G1923, PI4KII, PIK42A, RP11-548K23.6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PI4K2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PI4K2A pi4k2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PI4K2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.