Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.76kD).)

Mouse anti-Human EDAR Monoclonal Antibody | anti-EDAR antibody

EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR, Anhidrotic Ectodysplasin Receptor 1, Downless Homolog, EDA-A1 Receptor, Ectodermal Dysplasia Receptor, Ectodysplasin-A Receptor, FLJ94390) (AP)

Gene Names
EDAR; DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EDAR; Monoclonal Antibody; EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR; Anhidrotic Ectodysplasin Receptor 1; Downless Homolog; EDA-A1 Receptor; Ectodermal Dysplasia Receptor; Ectodysplasin-A Receptor; FLJ94390) (AP); anti-EDAR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6C12
Specificity
Recognizes human EDAR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EDAR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa64-179 from human EDAR (NP_071731) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.76kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.76kD).)

Western Blot (WB)

(EDAR monoclonal antibody Western Blot analysis of EDAR expression in human kidney.)

Western Blot (WB) (EDAR monoclonal antibody Western Blot analysis of EDAR expression in human kidney.)
Related Product Information for anti-EDAR antibody
The TNF family ligand ectodysplasin A (EDA) and its receptor EDAR are required for proper development of skin appendages such as hair, teeth and eccrine sweat glands. Loss of function mutations in the Eda gene cause X-linked hypohidrotic ectodermal dysplasia (XLHED), a condition that can be ameliorated in mice and dogs by timely administration of recombinant EDA. The Eda gene on the X chromosome is transcribed as multiple splice variants, only two of which code for the receptor-binding C-terminal TNF homology domain. These two variants code for 391- and 389aa-long proteins called EDA1 and EDA2. EDA1 binds EDAR, whereas EDA2 binds to another receptor, XEDAR. The biology of EDA2 and XEDAR is distinct from that of EDA1. Indeed, XEDAR-deficient mice have no obvious ectodermal dysplasia phenotype, whereas mice deficient in EDA, EDAR, or the signaling adaptor protein EDARADD all display virtually indistinguishable ectodermal dysplasia phenotypes, indicating the predominance of the EDA1-EDAR axis in the development of skin-derived appendages.
Product Categories/Family for anti-EDAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,690 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member EDAR
NCBI Official Synonym Full Names
ectodysplasin A receptor
NCBI Official Symbol
EDAR
NCBI Official Synonym Symbols
DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R
NCBI Protein Information
tumor necrosis factor receptor superfamily member EDAR
UniProt Protein Name
Tumor necrosis factor receptor superfamily member EDAR
UniProt Gene Name
EDAR
UniProt Synonym Gene Names
DL
UniProt Entry Name
EDAR_HUMAN

NCBI Description

This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]

Uniprot Description

EDAR: Receptor for EDA isoform A1, but not for EDA isoform A2. Mediates the activation of NF-kappa-B and JNK. May promote caspase-independent cell death. Defects in EDAR are a cause of ectodermal dysplasia anhidrotic (EDA); also known ectodermal dysplasia hypohidrotic autosomal recessive (HED). Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EDA is characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands. Defects in EDAR are the cause of ectodermal dysplasia type 3 (ED3); also known as ectodermal dysplasia hypohidrotic autosomal dominant or EDA3. ED3 is an autosomal dominant condition characterized by hypotrichosis, abnormal or missing teeth, and hypohidrosis due to the absence of sweat glands.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: apical part of cell; plasma membrane; integral to membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor activity

Biological Process: epidermis development; pigmentation; hair follicle development; apoptosis; positive regulation of NF-kappaB import into nucleus; cell differentiation; signal transduction; odontogenesis of dentine-containing teeth

Disease: Hair Morphology 1; Ectodermal Dysplasia 10a, Hypohidrotic/hair/nail Type, Autosomal Dominant; Ectodermal Dysplasia 10b, Hypohidrotic/hair/tooth Type, Autosomal Recessive

Research Articles on EDAR

Similar Products

Product Notes

The EDAR edar (Catalog #AAA6131051) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EDAR (Tumor Necrosis Factor Receptor Superfamily Member EDAR, Anhidrotic Ectodysplasin Receptor 1, Downless Homolog, EDA-A1 Receptor, Ectodermal Dysplasia Receptor, Ectodysplasin-A Receptor, FLJ94390) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDAR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDAR edar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDAR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.