Mouse anti-Human PI4K2A Monoclonal Antibody | anti-PI4K2A antibody

PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha, Phosphatidylinositol 4-kinase Type II-alpha, DKFZp761G1923, PI4KII, PIK42A, RP11-548K23.6) (PE)

Cat. Num. AAA6159450

• Gene Names: PI4K2A; PI4KII; PIK42A; DKFZp761G1923; RP11-548K23.6
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PI4K2A; Monoclonal Antibody; PI4K2A (Phosphatidylinositol 4-Kinase Type 2-alpha; Phosphatidylinositol 4-kinase Type II-alpha; DKFZp761G1923; PI4KII; PIK42A; RP11-548K23.6) (PE); anti-PI4K2A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E1
• Specificity: Recognizes human PI4KII.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PI4K2A antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa383-477 from human PI4KII (NP_060895) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PI4K2A is 1ng/ml as a capture antibody.)

Related Product Information for anti-PI4K2A antibody

Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs. PI4K II is activated by detergent and inhibited by adenosine. Overexpression of PI4KII in COS-7 cells increases synthesis of PtdIns4P. Some cells overexpressing PI4KII have scattered or no perinuclear Golgi. Knockdown of PI4KII by RNA interference (RNAi) does not disrupt the Golgi, and some cells show expanded Golgi. RNAi reduces the Golgi level of PtdIns4P and blocks the association between AP1 and the trans-Golgi network. PI4KII RNAi had little effect on intra-Golgi trafficking, but it inhibited export to plasma membrane export by 35%. It has been proposed that PI4KII generates PtdIns4P-rich domains within the Golgi that specify docking of the AP1 coat machinery.

Product Categories/Family for anti-PI4K2A antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 13559514
• NCBI GeneID: 55361
• NCBI Accession #: NP_060895.1
• NCBI GenBank Nucleotide #: NM_018425
• UniProt Accession #: Q9BTU6; Q9NSG8; D3DR59
• Molecular Weight: 54,022 Da
• NCBI Official Full Name: phosphatidylinositol 4-kinase type 2-alpha
• NCBI Official Synonym Full Names: phosphatidylinositol 4-kinase type 2 alpha
• NCBI Official Symbol: PI4K2A
• NCBI Official Synonym Symbols: PI4KII; PIK42A; DKFZp761G1923; RP11-548K23.6
• NCBI Protein Information: phosphatidylinositol 4-kinase type 2-alpha; OTTHUMP00000020224; OTTHUMP00000221793; phosphatidylinositol 4-kinase type II-alpha; phosphatidylinositol 4-kinase type II (PI4KII)
• UniProt Protein Name: Phosphatidylinositol 4-kinase type 2-alpha
• Protein Family: Phosphatidylinositol 4-kinase
• UniProt Gene Name: PI4K2A

NCBI Description

Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs (Barylko et al., 2001 [PubMed 11244087]).[supplied by OMIM]

Uniprot Description

PI4K2A: Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells. Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

Protein type: EC 2.7.1.67; Kinase, lipid; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q24.2

Cellular Component: cell soma; cytoplasmic vesicle; cytosol; dendrite; endosome; integral to plasma membrane; intrinsic to membrane; lipid raft; lysosomal membrane; membrane; mitochondrion; neuron projection; plasma membrane; presynaptic membrane; trans-Golgi network

Molecular Function: 1-phosphatidylinositol 4-kinase activity; ATP binding; protein binding

Biological Process: endosome organization and biogenesis; Golgi organization and biogenesis; phosphatidylinositol biosynthetic process; phosphoinositide phosphorylation