Western Blot (WB)
(WB Suggested Anti-PHF23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Rabbit PHF23 Polyclonal Antibody | anti-PHF23 antibody
PHF23 antibody - N-terminal region
Gene Names
PHF23; hJUNE-1b
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PHF23; Polyclonal Antibody; PHF23 antibody - N-terminal region; anti-PHF23 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPS
Sequence Length
403
Applicable Applications for anti-PHF23 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PHF23
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PHF23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-PHF23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-PHF23 antibody
This is a rabbit polyclonal antibody against PHF23. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PHF23 contains 1 PHD-type zinc finger. It belongs to the PHF23 family. A chromosomal aberration involving PHF23, translocation t (11;17)(p15;p13) with NUP98, is found in a patient with acute myeloid leukemia (AML).
Target Description: PHF23 contains 1 PHD-type zinc finger. It belongs to the PHF23 family. A chromosomal aberration involving PHF23, translocation t (11;17)(p15;p13) with NUP98, is found in a patient with acute myeloid leukemia (AML).
Product Categories/Family for anti-PHF23 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
PHD finger protein 23 isoform 1
NCBI Official Synonym Full Names
PHD finger protein 23
NCBI Official Symbol
PHF23
NCBI Official Synonym Symbols
hJUNE-1b
NCBI Protein Information
PHD finger protein 23
UniProt Protein Name
PHD finger protein 23
Protein Family
UniProt Gene Name
PHF23
UniProt Entry Name
PHF23_HUMAN
Uniprot Description
Involvement in disease: A chromosomal aberration involving PHF23 is found in a patient with acute myeloid leukemia (AML). Translocation t(11;17)(p15;p13) with NUP98.
Sequence similarities: Belongs to the PHF23 family.Contains 1 PHD-type zinc finger.
Sequence caution: The sequence ABK59096.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15498.1 differs from that shown. Reason: Frameshift at position 241.
Research Articles on PHF23
Similar Products
Product Notes
The PHF23 phf23 (Catalog #AAA3210260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHF23 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PHF23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PHF23 phf23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEAMAEPSPE DPPPTLKPET QPPEKRRRTI EDFNKFCSFV LAYAGYIPPS. It is sometimes possible for the material contained within the vial of "PHF23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
