Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PGPEP1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PGPEP1 Polyclonal Antibody | anti-PGPEP1 antibody

PGPEP1 Antibody - N-terminal region

Gene Names
PGPEP1; PGI; PGP; Pcp; PGPI; PAP-I; PGP-I
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PGPEP1; Polyclonal Antibody; PGPEP1 Antibody - N-terminal region; anti-PGPEP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGP
Sequence Length
209
Applicable Applications for anti-PGPEP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PGPEP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PGPEP1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PGPEP1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PGPEP1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PGPEP1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PGPEP1 antibody
This is a rabbit polyclonal antibody against PGPEP1. It was validated on Western Blot

Target Description: Pyroglutamyl peptidase I catalyzes the hydrolysis of N-terminal pyroglutamyl residues from oligopeptides and proteins.
Product Categories/Family for anti-PGPEP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
pyroglutamyl-peptidase 1 isoform 1
NCBI Official Synonym Full Names
pyroglutamyl-peptidase I
NCBI Official Symbol
PGPEP1
NCBI Official Synonym Symbols
PGI; PGP; Pcp; PGPI; PAP-I; PGP-I
NCBI Protein Information
pyroglutamyl-peptidase 1
UniProt Protein Name
Pyroglutamyl-peptidase 1
Protein Family
UniProt Gene Name
PGPEP1
UniProt Synonym Gene Names
PGPI; PAP-I; PGP-I
UniProt Entry Name
PGPI_HUMAN

NCBI Description

The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. [provided by RefSeq, Jul 2016]

Uniprot Description

PGPEP1: Removes 5-oxoproline from various penultimate amino acid residues except L-proline. Belongs to the peptidase C15 family.

Protein type: EC 3.4.19.3; Protease

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: cytosol

Molecular Function: pyroglutamyl-peptidase activity; cysteine-type peptidase activity

Biological Process: proteolysis

Research Articles on PGPEP1

Similar Products

Product Notes

The PGPEP1 pgpep1 (Catalog #AAA3217603) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGPEP1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PGPEP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PGPEP1 pgpep1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KHSPQLVVHV GVSGMATTVT LEKCGHNKGY KGLDNCRFCP GSQCCVEDGP. It is sometimes possible for the material contained within the vial of "PGPEP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.