Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PFKP AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole CellPFKP is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Rabbit anti-Human PFKP Polyclonal Antibody | anti-PFKP antibody

PFKP antibody - C-terminal region

Gene Names
PFKP; PFKF; PFK-C; PFK-P; ATP-PFK
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PFKP; Polyclonal Antibody; PFKP antibody - C-terminal region; anti-PFKP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EWITAKLKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHR
Sequence Length
784
Applicable Applications for anti-PFKP antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PFKP AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole CellPFKP is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Western Blot (WB) (WB Suggested Anti-PFKP AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole CellPFKP is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-PFKP antibody
This is a rabbit polyclonal antibody against PFKP. It was validated on Western Blot

Target Description: The PFKP gene encodes the platelet isoform of phosphofructokinase (PFK) (ATP:D-fructose-6-phosphate-1-phosphotransferase, EC 2.7.1.11). PFK catalyzes the irreversible conversion of fructose-6-phosphate to fructose-1,6-bisphosphate and is a key regulatory enzyme in glycolysis. The PFKP gene, which maps to chromosome 10p, is also expressed in fibroblasts. See also the muscle (PFKM; MIM 610681) and liver (PFKL; MIM 171860) isoforms of phosphofructokinase, which map to chromosomes 12q13 and 21q22, respectively. Vora (1981) [PubMed 6451249] determined that full tetrameric phophofructokinase enzyme expressed in platelets can be composed of subunits P4, P3L, and P2L2.
Product Categories/Family for anti-PFKP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
ATP-dependent 6-phosphofructokinase, platelet type isoform 1
NCBI Official Synonym Full Names
phosphofructokinase, platelet
NCBI Official Symbol
PFKP
NCBI Official Synonym Symbols
PFKF; PFK-C; PFK-P; ATP-PFK
NCBI Protein Information
ATP-dependent 6-phosphofructokinase, platelet type
UniProt Protein Name
6-phosphofructokinase type C
UniProt Gene Name
PFKP
UniProt Synonym Gene Names
PFKF; PFK-C
UniProt Entry Name
K6PP_HUMAN

NCBI Description

This gene encodes a member of the phosphofructokinase A protein family. The encoded enzyme is the platelet-specific isoform of phosphofructokinase and plays a key role in glycolysis regulation. This gene may play a role in metabolic reprogramming in some cancers, including clear cell renal cell carcinomas, and cancer of the bladder, breast, and lung. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Uniprot Description

PFKP: phosphofructokinase, platelet type. An ubiquitous metabolic enzyme involved in the synthesis and degradation of fructose 2,6-bisphosphate. Key control step of glycolysis. An allosteric enzyme activated by ADP, AMP, or fructose bisphosphate and inhibited by ATP or citrate. Activity: ATP D-fructose 6-phosphate = ADP D-fructose 1,6-bisphosphate. The holoenzyme consists of 4 subunits. The liver and muscle enzymes are homo-tetramers of four liver or muscle isoforms, respectively. The red blood cell enzyme consists hetero-tetramers of the muscle and liver isoforms. A subunit composition with a higher proportion of platelet type subunits is found in platelets, brain and fibroblasts.

Protein type: Carbohydrate Metabolism - pentose phosphate pathway; Kinase, other; Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - fructose and mannose; EC 2.7.1.11; Carbohydrate Metabolism - glycolysis and gluconeogenesis

Chromosomal Location of Human Ortholog: 10p15.3-p15.2

Cellular Component: membrane; nucleus; cytosol

Molecular Function: metal ion binding; protein complex binding; 6-phosphofructokinase activity; ATP binding

Biological Process: glycolysis; carbohydrate metabolic process; carbohydrate phosphorylation; glucose metabolic process; pathogenesis; fructose 6-phosphate metabolic process

Research Articles on PFKP

Similar Products

Product Notes

The PFKP pfkp (Catalog #AAA3215372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PFKP antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PFKP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PFKP pfkp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EWITAKLKEA RGRGKKFTTD DSICVLGISK RNVIFQPVAE LKKQTDFEHR. It is sometimes possible for the material contained within the vial of "PFKP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.