Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PFKL Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysatePFKL is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit PFKL Polyclonal Antibody | anti-PFKL antibody

PFKL antibody - middle region

Gene Names
PFKL; PFK-B; PFK-L; ATP-PFK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PFKL; Polyclonal Antibody; PFKL antibody - middle region; anti-PFKL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA
Sequence Length
568
Applicable Applications for anti-PFKL antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PFKL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PFKL Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysatePFKL is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-PFKL Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysatePFKL is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(WB Suggested Anti-PFKL Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)

Western Blot (WB) (WB Suggested Anti-PFKL Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)
Related Product Information for anti-PFKL antibody
This is a rabbit polyclonal antibody against PFKL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
Product Categories/Family for anti-PFKL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
PFKL protein, partial
NCBI Official Synonym Full Names
phosphofructokinase, liver type
NCBI Official Symbol
PFKL
NCBI Official Synonym Symbols
PFK-B; PFK-L; ATP-PFK
NCBI Protein Information
ATP-dependent 6-phosphofructokinase, liver type
UniProt Protein Name
6-phosphofructokinase, liver type
UniProt Gene Name
PFKL
UniProt Synonym Gene Names
PFK-B
UniProt Entry Name
K6PL_HUMAN

NCBI Description

This gene encodes the liver (L) subunit of an enzyme that catalyzes the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate, which is a key step in glucose metabolism (glycolysis). This enzyme is a tetramer that may be composed of different subunits encoded by distinct genes in different tissues. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

PFKL: phosphofructokinase, liver type. An ubiquitous metabolic enzyme involved in the synthesis and degradation of fructose 2,6-bisphosphate. Key control step of glycolysis. An allosteric enzyme activated by ADP, AMP, or fructose bisphosphate and inhibited by ATP or citrate. Activity: ATP D-fructose 6-phosphate = ADP D-fructose 1,6-bisphosphate. The holoenzyme consists of 4 subunits. The liver and muscle enzymes are homo-tetramers of four liver or muscle isoforms, respectively. The red blood cell enzyme consists hetero-tetramers of the muscle and liver isoforms. A subunit composition with a higher proportion of platelet type subunits is found in platelets, brain and fibroblasts. Two alternatively spliced isoforms have been described.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - pentose phosphate pathway; EC 2.7.1.11; Carbohydrate Metabolism - galactose; Kinase, other; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: 6-phosphofructokinase complex; membrane; cytosol

Molecular Function: identical protein binding; protein binding; metal ion binding; kinase binding; ATP binding; 6-phosphofructokinase activity

Biological Process: fructose 1,6-bisphosphate metabolic process; glycolysis; carbohydrate metabolic process; carbohydrate phosphorylation; response to glucose stimulus; glucose metabolic process; pathogenesis; fructose 6-phosphate metabolic process; protein oligomerization; protein homotetramerization; negative regulation of insulin secretion

Research Articles on PFKL

Similar Products

Product Notes

The PFKL pfkl (Catalog #AAA3207910) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PFKL antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PFKL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PFKL pfkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTNVLGHLQQ GGAPTPFDRN YGTKLGVKAM LWLSEKLREV YRKGRVFANA. It is sometimes possible for the material contained within the vial of "PFKL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.