Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Pea3 Picoband antibody, MBS177881, Western blottingAll lanes: Anti Pea3 (MBS177881) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 68KD)

anti-Human, Rat Pea3 Polyclonal Antibody | anti-Pea3 antibody

Anti-Pea3 Antibody

Gene Names
ETV4; E1AF; PEA3; E1A-F; PEAS3
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Pea3; Polyclonal Antibody; Anti-Pea3 Antibody; ETS translocation variant 4; Adenovirus E1A enhancer binding protein; Adenovirus E1A enhancer-binding protein; E1A F; E1A-F; ets variant gene 4 (E1A enhancer binding protein E1AF); ETV4; ETV4_HUMAN; PEA3; PEA3 protein; PEAS3; Polyomavirus enhancer activator 3; Polyomavirus enhancer activator 3 homolog; Protein PEA3; ets variant 4; anti-Pea3 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
484
Applicable Applications for anti-Pea3 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Pea3 Picoband antibody, MBS177881, Western blottingAll lanes: Anti Pea3 (MBS177881) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 68KD)

Western Blot (WB) (Anti- Pea3 Picoband antibody, MBS177881, Western blottingAll lanes: Anti Pea3 (MBS177881) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 68KD)
Related Product Information for anti-Pea3 antibody
Description: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human;Rat.

Background: ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.
References
1. Davidson B, Goldberg I, Tell L, et al. (2004). "The clinical role of the PEA3 transcription factor in ovarian and breast carcinoma in effusions". Clin. Exp. Metastasis 21 (3): 191-9. 2. Higashino, F., Yoshida, K., Noumi, T., Seiki, M., Fujinaga, K. Ets-related protein E1A-F can activate three different matrix metalloproteinase gene promoters. Oncogene 10: 1461-1463, 1995.  3. Isobe M, Yamagishi F, Yoshida K, Higashino F, Fujinaga K (Feb 1996). "Assignment of the ets-related transcription factor E1A-F gene (ETV4) to human chromosome region 17q21". Genomics 28 (2): 357-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,422 Da
NCBI Official Full Name
ETS translocation variant 4 isoform 1
NCBI Official Synonym Full Names
ETS variant 4
NCBI Official Symbol
ETV4
NCBI Official Synonym Symbols
E1AF; PEA3; E1A-F; PEAS3
NCBI Protein Information
ETS translocation variant 4
UniProt Protein Name
ETS translocation variant 4
UniProt Gene Name
ETV4
UniProt Synonym Gene Names
E1AF; PEA3; Protein PEA3
UniProt Entry Name
ETV4_HUMAN

Uniprot Description

ETV4: Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'. Belongs to the ETS family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleolus; nucleoplasm; nucleus

Molecular Function: protein binding

Biological Process: cell differentiation; motor axon guidance; negative regulation of mammary gland epithelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; stem cell differentiation; transcription from RNA polymerase II promoter

Research Articles on Pea3

Similar Products

Product Notes

The Pea3 etv4 (Catalog #AAA177881) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Pea3 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Pea3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the Pea3 etv4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Pea3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.