Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: PCBP1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit PCBP1 Polyclonal Antibody | anti-PCBP1 antibody

PCBP1 antibody - middle region

Gene Names
PCBP1; HNRPX; HNRPE1; hnRNP-X; HEL-S-85; hnRNP-E1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PCBP1; Polyclonal Antibody; PCBP1 antibody - middle region; anti-PCBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
Sequence Length
356
Applicable Applications for anti-PCBP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: PCBP1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PCBP1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PCBP1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: PCBP1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(WB Suggested Anti-PCBP1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysatePCBP1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-PCBP1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysatePCBP1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-PCBP1 antibody
This is a rabbit polyclonal antibody against PCBP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
poly(rC)-binding protein 1
NCBI Official Synonym Full Names
poly(rC) binding protein 1
NCBI Official Symbol
PCBP1
NCBI Official Synonym Symbols
HNRPX; HNRPE1; hnRNP-X; HEL-S-85; hnRNP-E1
NCBI Protein Information
poly(rC)-binding protein 1
UniProt Protein Name
Poly(rC)-binding protein 1
Protein Family
UniProt Gene Name
PCBP1
UniProt Synonym Gene Names
hnRNP E1
UniProt Entry Name
PCBP1_HUMAN

NCBI Description

This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP E1: Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands.

Protein type: RNA splicing; Translation; RNA-binding

Chromosomal Location of Human Ortholog: 2p13-p12

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; membrane; cytoplasm; ribonucleoprotein complex

Molecular Function: protein binding; RNA binding; single-stranded DNA binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression

Research Articles on PCBP1

Similar Products

Product Notes

The PCBP1 pcbp1 (Catalog #AAA3205373) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCBP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PCBP1 pcbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSDAVGYPHA THDLEGPPLD AYSIQGQHTI SPLDLAKLNQ VARQQSHFAM. It is sometimes possible for the material contained within the vial of "PCBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.