Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Stomach)

Rabbit PARP3 Polyclonal Antibody | anti-PARP3 antibody

PARP3 Antibody - C-terminal region

Gene Names
PARP3; IRT1; ARTD3; ADPRT3; ADPRTL2; ADPRTL3; PADPRT-3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PARP3; Polyclonal Antibody; PARP3 Antibody - C-terminal region; anti-PARP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP
Sequence Length
532
Applicable Applications for anti-PARP3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 91%; Horse: 100%; Human: 100%; Mouse: 77%; Pig: 85%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PARP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Stomach)

Immunohistochemistry (IHC) (Human Stomach)

Western Blot (WB)

(WB Suggested Anti-PARP3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PARP3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-PARP3 antibody
This is a rabbit polyclonal antibody against PARP3. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by this gene belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. This gene encodes the poly(ADP-ribosyl)transferase 3, which is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
protein mono-ADP-ribosyltransferase PARP3 isoform b
NCBI Official Synonym Full Names
poly(ADP-ribose) polymerase family member 3
NCBI Official Symbol
PARP3
NCBI Official Synonym Symbols
IRT1; ARTD3; ADPRT3; ADPRTL2; ADPRTL3; PADPRT-3
NCBI Protein Information
protein mono-ADP-ribosyltransferase PARP3; poly [ADP-ribose] polymerase 3
UniProt Protein Name
Poly [ADP-ribose] polymerase 3
UniProt Gene Name
PARP3
UniProt Synonym Gene Names
ADPRT3; ADPRTL3; PARP-3; hPARP-3; ARTD3; ADPRT-3; pADPRT-3
UniProt Entry Name
PARP3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. This gene encodes the poly(ADP-ribosyl)transferase 3, which is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PARP3: Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. May link the DNA damage surveillance network to the mitotic fidelity checkpoint. Negatively influences the G1/S cell cycle progression without interfering with centrosome duplication. Binds DNA. May be involved in the regulation of PRC2 and PRC3 complex-dependent gene silencing. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.2.30; DNA repair, damage; Transferase

Chromosomal Location of Human Ortholog: 3p21.2

Cellular Component: centriole; nucleus

Molecular Function: catalytic activity; NAD+ ADP-ribosyltransferase activity

Biological Process: protein amino acid ADP-ribosylation; double-strand break repair; positive regulation of DNA ligation; DNA repair; telomere maintenance

Research Articles on PARP3

Similar Products

Product Notes

The PARP3 parp3 (Catalog #AAA3201708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARP3 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PARP3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PARP3 parp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGREHHINTD NPSLKSPPPG FDSVIARGHT EPDPTQDTEL ELDGQQVVVP. It is sometimes possible for the material contained within the vial of "PARP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.