Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC25A3 polyclonal antibody. Western Blot analysis of SLC25A3 expression in human pancreas.)

Mouse anti-Human SLC25A3 Polyclonal Antibody | anti-SLC25A3 antibody

SLC25A3 (Phosphate Carrier Protein, Mitochondrial, Phosphate Transport Protein, PTP, Solute Carrier Family 25 Member 3, PHC, OK/SW-cl.48)

Gene Names
SLC25A3; PHC; PTP; OK/SW-cl.48
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC25A3; Polyclonal Antibody; SLC25A3 (Phosphate Carrier Protein; Mitochondrial; Phosphate Transport Protein; PTP; Solute Carrier Family 25 Member 3; PHC; OK/SW-cl.48); Anti -SLC25A3 (Phosphate Carrier Protein; anti-SLC25A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SLC25A3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ
Applicable Applications for anti-SLC25A3 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human SLC25A3, aa1-361 (NP_002626.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SLC25A3 polyclonal antibody. Western Blot analysis of SLC25A3 expression in human pancreas.)

Western Blot (WB) (SLC25A3 polyclonal antibody. Western Blot analysis of SLC25A3 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of SLC25A3 expression in transfected 293T cell line by SLC25A3 polyclonal antibody. Lane 1: SLC25A3 transfected lysate (39.71kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC25A3 expression in transfected 293T cell line by SLC25A3 polyclonal antibody. Lane 1: SLC25A3 transfected lysate (39.71kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to SLC25A3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to SLC25A3 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-SLC25A3 antibody
Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H+.
Product Categories/Family for anti-SLC25A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40,095 Da
NCBI Official Full Name
SLC25A3 protein, partial
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3
NCBI Official Symbol
SLC25A3
NCBI Official Synonym Symbols
PHC; PTP; OK/SW-cl.48
NCBI Protein Information
phosphate carrier protein, mitochondrial; phosphate transport protein; solute carrier family 25 member 3; mitochondrial phosphate carrier protein
UniProt Protein Name
Phosphate carrier protein, mitochondrial
UniProt Gene Name
SLC25A3
UniProt Synonym Gene Names
PHC; PTP
UniProt Entry Name
MPCP_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC25A3: Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+). Defects in SLC25A3 are a cause of mitochondrial phosphate carrier deficiency (MPCD). MPCD is a fatal disorder of oxidative phosphorylation. Patients have lactic acidosis, hypertrophic cardiomyopathy and muscular hypotonia and die within the first year of life. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transporter; Mitochondrial; Membrane protein, integral; Transporter, SLC family

Chromosomal Location of Human Ortholog: 12q23

Cellular Component: membrane; mitochondrion; integral to plasma membrane; mitochondrial inner membrane

Molecular Function: phosphate carrier activity; symporter activity; protein complex binding

Biological Process: generation of precursor metabolites and energy; transport

Disease: Mitochondrial Phosphate Carrier Deficiency

Research Articles on SLC25A3

Similar Products

Product Notes

The SLC25A3 slc25a3 (Catalog #AAA644571) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A3 (Phosphate Carrier Protein, Mitochondrial, Phosphate Transport Protein, PTP, Solute Carrier Family 25 Member 3, PHC, OK/SW-cl.48) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the SLC25A3 slc25a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFSSVAHLAR ANPFNTPHLQ LVHDGLGDLR SSSPGPTGQP RRPRNLAAAA VEEYSCEFGS AKYYALCGFG GVLSCGLTHT AVVPLDLVKC RMQVDPQKYK GIFNGFSVTL KEDGVRGLAK GWAPTFLGYS MQGLCKFGFY EVFKVLYSNM LGEENTYLWR TSLYLAASAS AEFFADIALA PMEAAKVRIQ TQPGYANTLR DAAPKMYKEE GLKAFYKGVA PLWMRQIPYT MMKFACFERT VEALYKFVVP KPRSECSKPE QLVVTFVAGY IAGVFCAIVS HPADSVVSVL NKEKGSSASL VLKRLGFKGV WKGLFARIIM IGTLTALQWF IYDSVKVYFR LPRPPPPEMP ESLKKKLGLT Q. It is sometimes possible for the material contained within the vial of "SLC25A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.