Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Human brain stem cells (NT2) Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: PABPC1 Blue: DAPIGene Name :PABPC1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit PABPC1 Polyclonal Antibody | anti-PABPC1 antibody

PABPC1 antibody - middle region

Gene Names
PABPC1; PAB1; PABP; PABP1; PABPC2; PABPL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PABPC1; Polyclonal Antibody; PABPC1 antibody - middle region; anti-PABPC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
Sequence Length
636
Applicable Applications for anti-PABPC1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PABPC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human brain stem cells (NT2) Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: PABPC1 Blue: DAPIGene Name :PABPC1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunohistochemistry (IHC) (Sample Type :Human brain stem cells (NT2) Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: PABPC1 Blue: DAPIGene Name :PABPC1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-PABPC1 antibody
This is a rabbit polyclonal antibody against PABPC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4; MIM 603407), and PABP3 (PABPC3; MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4; MIM 603407), and PABP3 (PABPC3; MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
polyadenylate-binding protein 1
NCBI Official Synonym Full Names
poly(A) binding protein cytoplasmic 1
NCBI Official Symbol
PABPC1
NCBI Official Synonym Symbols
PAB1; PABP; PABP1; PABPC2; PABPL1
NCBI Protein Information
polyadenylate-binding protein 1
UniProt Protein Name
Polyadenylate-binding protein 1
UniProt Gene Name
PABPC1
UniProt Synonym Gene Names
PAB1; PABP1; PABPC2; PABP-1; Poly(A)-binding protein 1
UniProt Entry Name
PABP1_HUMAN

NCBI Description

This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.[provided by RefSeq, Aug 2010]

Uniprot Description

PABP 1: poly(A) binding protein 1. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Shuttles between the cytoplasm and the nucleus. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. A potential substrate in MAPKAP kinase 2-induced mRNA stabilization. Two alternatively spliced isoforms have been described.

Protein type: Spliceosome; Translation; Motility/polarity/chemotaxis; RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 8q22.2-q23

Cellular Component: focal adhesion; membrane; stress granule; cytoplasm; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein C-terminus binding; protein binding; translation activator activity; nucleotide binding; poly(U) binding; poly(A) binding

Biological Process: nuclear mRNA splicing, via spliceosome; poly(A) tail shortening; cellular protein metabolic process; translation; positive regulation of translation; mRNA stabilization; mRNA catabolic process, nonsense-mediated decay; translational initiation; mRNA polyadenylation; gene expression; RNA-mediated gene silencing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on PABPC1

Similar Products

Product Notes

The PABPC1 pabpc1 (Catalog #AAA3205203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PABPC1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PABPC1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PABPC1 pabpc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRPSPRWTAQ GARPHPFQNM PGAIRPAAPR PPFSTMRPAS SQVPRVMSTQ. It is sometimes possible for the material contained within the vial of "PABPC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.