Mouse anti-Human DNAI1 Monoclonal Antibody | anti-DNAI1 antibody

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (MaxLight 750)

Cat. Num. AAA6232529

• Gene Names: DNAI1; PCD; DIC1; ICS1; CILD1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DNAI1; Monoclonal Antibody; DNAI1 (Dynein Intermediate Chain 1; Axonemal; Axonemal Dynein Intermediate Chain 1) (MaxLight 750); anti-DNAI1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D10-2A5
• Specificity: Recognizes human DNAI1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
• Sequence Length: 2525

• Applicable Applications for anti-DNAI1 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-699 from human DNAI1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MIPASAKSPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTCNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVA
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using MBS644769 (103kD).)

Related Product Information for anti-DNAI1 antibody

The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. This gene encodes an intermediate chain dynein, belonging to the large family of motor proteins. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia (PCD) and Kartagener syndrome.

Product Categories/Family for anti-DNAI1 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 34192150
• NCBI GeneID: 27019
• NCBI Official Full Name: Homo sapiens dynein, axonemal, intermediate chain 1, mRNA
• NCBI Official Synonym Full Names: dynein axonemal intermediate chain 1
• NCBI Official Symbol: DNAI1
• NCBI Official Synonym Symbols: PCD; DIC1; ICS1; CILD1
• NCBI Protein Information: dynein intermediate chain 1, axonemal
• Protein Family: Dynein

NCBI Description

This gene encodes a member of the dynein intermediate chain family. The encoded protein is part of the dynein complex in respiratory cilia. The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia and Kartagener syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]