Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: OXYRSample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit OXYR Polyclonal Antibody | anti-OXTR antibody

OXYR Antibody - C-terminal region

Gene Names
OXTR; OT-R
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
OXYR; Polyclonal Antibody; OXYR Antibody - C-terminal region; anti-OXTR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQ
Sequence Length
389
Applicable Applications for anti-OXTR antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human OXYR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OXYRSample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OXYRSample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OXTR antibody
oxytocin receptor

Target Description: The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin receptor system plays an important role in the uterus during parturition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
oxytocin receptor
NCBI Official Synonym Full Names
oxytocin receptor
NCBI Official Symbol
OXTR
NCBI Official Synonym Symbols
OT-R
NCBI Protein Information
oxytocin receptor
UniProt Protein Name
Oxytocin receptor
Protein Family
UniProt Gene Name
OXTR
UniProt Synonym Gene Names
OT-R
UniProt Entry Name
OXYR_HUMAN

NCBI Description

The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin receptor system plays an important role in the uterus during parturition. [provided by RefSeq, Jul 2008]

Uniprot Description

OXTR: Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol- calcium second messenger system. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: microvillus; cell-cell adherens junction; integral to plasma membrane; apical plasma membrane; plasma membrane

Molecular Function: oxytocin receptor activity; peptide hormone binding; peptide binding; vasopressin receptor activity

Biological Process: lactation; response to peptide hormone stimulus; response to anoxia; heart development; female pregnancy; positive regulation of synaptic transmission, glutamatergic; response to estradiol stimulus; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; muscle contraction; response to drug; maternal behavior; eating behavior; response to amphetamine; positive regulation of synaptic transmission, GABAergic; social behavior; response to cocaine; sleep; memory; cellular response to hormone stimulus; G-protein coupled receptor protein signaling pathway; positive regulation of synaptogenesis; telencephalon development; regulation of systemic arterial blood pressure by vasopressin; suckling behavior; gut development; response to cytokine stimulus; maternal process involved in parturition; positive regulation of vasoconstriction; sperm ejaculation; response to progesterone stimulus; positive regulation of blood pressure

Research Articles on OXTR

Similar Products

Product Notes

The OXTR oxtr (Catalog #AAA3214392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OXYR Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OXYR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OXTR oxtr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFTGHLFHEL VQRFLCCSAS YLKGRRLGET SASKKSNSSS FVLSHRSSSQ. It is sometimes possible for the material contained within the vial of "OXYR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.