Western Blot (WB)
(WB Suggested Anti-OTOP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Rabbit OTOP1 Polyclonal Antibody | anti-OTOP1 antibody
OTOP1 Antibody - C-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OTOP1; Polyclonal Antibody; OTOP1 Antibody - C-terminal region; anti-OTOP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL
Sequence Length
612
Applicable Applications for anti-OTOP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OTOP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-OTOP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Western Blot (WB)
(WB Suggested Anti-OTOP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-OTOP1 antibody
This is a rabbit polyclonal antibody against OTOP1. It was validated on Western Blot
Target Description: OTOP1 is required for normal formation of otoconia in the inner ear. OTOP1 inhibits P2Y purinoceptors and modulates calcium homeostasis and influx of calcium in response to extracellular ATP.
Target Description: OTOP1 is required for normal formation of otoconia in the inner ear. OTOP1 inhibits P2Y purinoceptors and modulates calcium homeostasis and influx of calcium in response to extracellular ATP.
Product Categories/Family for anti-OTOP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
proton channel OTOP1
NCBI Official Synonym Full Names
otopetrin 1
NCBI Official Symbol
OTOP1
NCBI Protein Information
proton channel OTOP1
UniProt Protein Name
Otopetrin-1
Protein Family
UniProt Gene Name
OTOP1
UniProt Entry Name
OTOP1_HUMAN
NCBI Description
This gene encodes a transmembrane protein which belongs to the otopetrin domain protein family and is required for the formation of otoconia and otoliths, calcium carbonate biominerals within the inner ear of mammals that are required for the detection of linear acceleration and gravity. This gene modulates purinergic control of intracellular calcium in vestibular supporting cells. Naturally occurring mutations in the orthologous mouse gene are associated with nonsyndromic otoconia agenesis and a consequent balance defect. The orthologous mouse gene is also induced in white adipose tissue during obesity. The encoded protein is a component of a counterinflammatory pathway that attenuates obesity-induced adipose tissue inflammation and plays an adaptive role in maintaining metabolic homeostasis in obesity. [provided by RefSeq, Jul 2017]
Similar Products
Product Notes
The OTOP1 otop1 (Catalog #AAA3216921) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTOP1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OTOP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTOP1 otop1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTKSESALIM FYLYAITLLM LMGAAGLAGI RIYRIDEKSL DESKNPARKL. It is sometimes possible for the material contained within the vial of "OTOP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
