Western Blot (WB)
(Host: RabbitTarget Name: PCGF2Sample Tissue: Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PCGF2 Polyclonal Antibody | anti-PCGF2 antibody
PCGF2 Antibody - middle region
Gene Names
PCGF2; MEL-18; RNF110; ZNF144
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PCGF2; Polyclonal Antibody; PCGF2 Antibody - middle region; anti-PCGF2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: EQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRC
Sequence Length
344
Applicable Applications for anti-PCGF2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCGF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PCGF2Sample Tissue: Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PCGF2Sample Tissue: Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PCGF2 antibody
The protein encoded by this gene contains a RING finger motif and is similar to the polycomb group (PcG) gene products. PcG gene products form complexes via protein-protein interaction and maintain the transcription repression of genes involved in embryogenesis, cell cycles, and tumorigenesis. This protein was shown to act as a negative regulator of transcription and has tumor suppressor activity. The expression of this gene was detected in various tumor cells, but is limited in neural organs in normal tissues. Knockout studies in mice suggested that this protein may negatively regulate the expression of different cytokines, chemokines, and chemokine receptors, and thus plays an important role in lymphocyte differentiation and migration, as well as in immune responses.
Product Categories/Family for anti-PCGF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
polycomb group RING finger protein 2
NCBI Official Synonym Full Names
polycomb group ring finger 2
NCBI Official Symbol
PCGF2
NCBI Official Synonym Symbols
MEL-18; RNF110; ZNF144
NCBI Protein Information
polycomb group RING finger protein 2
UniProt Protein Name
Polycomb group RING finger protein 2
Protein Family
UniProt Gene Name
PCGF2
UniProt Synonym Gene Names
MEL18; RNF110; ZNF144
UniProt Entry Name
PCGF2_HUMAN
NCBI Description
The protein encoded by this gene contains a RING finger motif and is similar to the polycomb group (PcG) gene products. PcG gene products form complexes via protein-protein interaction and maintain the transcription repression of genes involved in embryogenesis, cell cycles, and tumorigenesis. This protein was shown to act as a negative regulator of transcription and has tumor suppressor activity. The expression of this gene was detected in various tumor cells, but is limited in neural organs in normal tissues. Knockout studies in mice suggested that this protein may negatively regulate the expression of different cytokines, chemokines, and chemokine receptors, and thus plays an important role in lymphocyte differentiation and migration, as well as in immune responses. [provided by RefSeq, Jul 2008]
Research Articles on PCGF2
Similar Products
Product Notes
The PCGF2 pcgf2 (Catalog #AAA3219798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCGF2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCGF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PCGF2 pcgf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQEKGALSDD EIVSLSIEFY EGARDRDEKK GPLENGDGDK EKTGVRFLRC. It is sometimes possible for the material contained within the vial of "PCGF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
