Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RHOU Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Rabbit RHOU Polyclonal Antibody | anti-RHOU antibody

RHOU antibody - C-terminal region

Gene Names
RHOU; ARHU; G28K; WRCH1; hG28K; CDC42L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHOU; Polyclonal Antibody; RHOU antibody - C-terminal region; anti-RHOU antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV
Sequence Length
258
Applicable Applications for anti-RHOU antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RHOU Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-RHOU Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-RHOU antibody
This is a rabbit polyclonal antibody against RHOU. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoU
NCBI Official Synonym Full Names
ras homolog family member U
NCBI Official Symbol
RHOU
NCBI Official Synonym Symbols
ARHU; G28K; WRCH1; hG28K; CDC42L1
NCBI Protein Information
rho-related GTP-binding protein RhoU
UniProt Protein Name
Rho-related GTP-binding protein RhoU
UniProt Gene Name
RHOU
UniProt Synonym Gene Names
WRCH-1
UniProt Entry Name
RHOU_HUMAN

NCBI Description

This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.[provided by RefSeq, Mar 2011]

Uniprot Description

RHOU: Acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Stimulates quiescent cells to reenter the cell cycle. Has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP- bound. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. Belongs to the small GTPase superfamily. Rho family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric, Rho; G protein, monomeric; Motility/polarity/chemotaxis; G protein

Chromosomal Location of Human Ortholog: 1q42.11-q42.3

Cellular Component: Golgi membrane; cell projection; focal adhesion; plasma membrane; podosome; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding; metal ion binding

Biological Process: regulation of cell shape; regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; Rac protein signal transduction; cytoskeleton organization and biogenesis; actin cytoskeleton organization and biogenesis; G1/S transition of mitotic cell cycle

Research Articles on RHOU

Similar Products

Product Notes

The RHOU rhou (Catalog #AAA3205750) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOU antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RHOU can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOU rhou for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKEVFDAAIV AGIQYSDTQQ QPKKSKSRTP DKMKNLSKSW WKKYCCFV. It is sometimes possible for the material contained within the vial of "RHOU, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.