Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (OSBPL8 antibody (MBS5302875) used at 1 ug/ml to detect target protein.)

Rabbit OSBPL8 Polyclonal Antibody | anti-OSBPL8 antibody

OSBPL8 antibody

Gene Names
OSBPL8; ORP8; MST120; OSBP10; MSTP120
Applications
Western Blot
Purity
Affinity purified
Synonyms
OSBPL8; Polyclonal Antibody; OSBPL8 antibody; Polyclonal OSBPL8; Anti-OSBPL8; MGC126578; OSBPL-8; Oxysterol Binding Protein-Like 8; OSBPL 8; ORP8; MGC133203; OSBP10; DKFZp686A11164; MSTP120; MST120; anti-OSBPL8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
OSBPL8 antibody was raised against the middle region of OSBPL8
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSBPL8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
728
Applicable Applications for anti-OSBPL8 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.
Cross-Reactivity
Human
Immunogen
OSBPL8 antibody was raised using the middle region of OSBPL8 corresponding to a region with amino acids YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(OSBPL8 antibody (MBS5302875) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (OSBPL8 antibody (MBS5302875) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-OSBPL8 antibody
Rabbit polyclonal OSBPL8 antibody raised against the middle region of OSBPL8
Product Categories/Family for anti-OSBPL8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
97 kDa (MW of target protein)
NCBI Official Full Name
OSBPL8 protein, partial
NCBI Official Synonym Full Names
oxysterol binding protein-like 8
NCBI Official Symbol
OSBPL8
NCBI Official Synonym Symbols
ORP8; MST120; OSBP10; MSTP120
NCBI Protein Information
oxysterol-binding protein-related protein 8
UniProt Protein Name
Oxysterol-binding protein-related protein 8
UniProt Gene Name
OSBPL8
UniProt Synonym Gene Names
KIAA1451; ORP8; OSBP10; ORP-8; OSBP-related protein 8
UniProt Entry Name
OSBL8_HUMAN

NCBI Description

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

OSBPL8: a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two splice variant isoforms have been described.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: nuclear membrane; membrane

Molecular Function: cholesterol binding

Biological Process: fat cell differentiation; positive regulation of protein kinase B signaling cascade; positive regulation of insulin receptor signaling pathway; lipid transport; negative regulation of cell migration

Research Articles on OSBPL8

Similar Products

Product Notes

The OSBPL8 osbpl8 (Catalog #AAA5302875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's OSBPL8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the OSBPL8 osbpl8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSBPL8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.