Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OR2W5 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)

Rabbit anti-Human OR2W5 Polyclonal Antibody | anti-OR2W5 antibody

OR2W5 antibody - middle region

Gene Names
OR2W5; OR2W5P; OST722
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OR2W5; Polyclonal Antibody; OR2W5 antibody - middle region; anti-OR2W5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT
Sequence Length
320
Applicable Applications for anti-OR2W5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OR2W5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OR2W5 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-OR2W5 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Related Product Information for anti-OR2W5 antibody
This is a rabbit polyclonal antibody against OR2W5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene has a coding sequence that is comparable in length to other olfactory receptor genes, but it should be noted that a frameshift is present in the 3' coding region that disrupts the 7-transmembrane domain structure in the protein. It is unclear if the protein can function as an olfactory receptor or if an alternate function is served. For this reason, this gene has also been interpreted to be a pseudogene.
Product Categories/Family for anti-OR2W5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
putative olfactory receptor 2W5
NCBI Official Synonym Full Names
olfactory receptor family 2 subfamily W member 5 (gene/pseudogene)
NCBI Official Symbol
OR2W5
NCBI Official Synonym Symbols
OR2W5P; OST722
NCBI Protein Information
putative olfactory receptor 2W5
UniProt Protein Name
Putative olfactory receptor 2W5
UniProt Gene Name
OR2W5
UniProt Synonym Gene Names
OR2W5P

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene has a coding sequence that is comparable in length to other olfactory receptor genes, but it should be noted that a frameshift is present in the 3' coding region that disrupts the 7-transmembrane domain structure in the protein. It is unclear if the protein can function as an olfactory receptor or if an alternate function is served. For this reason, this gene has also been interpreted to be a pseudogene. [provided by RefSeq, Jan 2010]

Uniprot Description

OR2W5: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: integral component of membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: detection of chemical stimulus involved in sensory perception of smell; G-protein coupled receptor signaling pathway; sensory perception of smell

Similar Products

Product Notes

The OR2W5 or2w5 (Catalog #AAA3207398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OR2W5 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OR2W5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OR2W5 or2w5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGEVPDSLLH HRHSQHQPPH LHFEEQGCEG DHEETSGVGE RGWGASTRGT. It is sometimes possible for the material contained within the vial of "OR2W5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.